DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5 and bap1

DIOPT Version :9

Sequence 1:NP_001261632.1 Gene:Uch-L5 / 39102 FlyBaseID:FBgn0011327 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001157309.1 Gene:bap1 / 558885 ZFINID:ZDB-GENE-050208-492 Length:755 Species:Danio rerio


Alignment Length:282 Identity:108/282 - (38%)
Similarity:161/282 - (57%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQEDEPAGKV---- 68
            |..:|||||:||.|:.:||..|.|||||:.|.|   |...|::|.||||||::|.....||    
Zfish     5 WLELESDPGLFTLLVEDFGVKGVQVEEIYDLQS---KCQSPVYGFIFLFKWIEERRSRRKVSTLV 66

  Fly    69 ----VLDRE---NIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQCFDPYNKGL 126
                |:|.:   ::|||.|:|.|:|||.|:||:|:|.  ..::||.||:..|.|.:.|:|.:||.
Zfish    67 DETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNC--SGVELGMTLSRMKAFTKGFNPESKGY 129

  Fly   127 TLSNASQIRTVHNSFARPTLFELDTK----NQKKDDDVYHFVGYMPIGGRLYELDGLREGPIDLG 187
            .:.||.::...|||.|||....|..|    :..:..:.:|||.|:||..||:|||||:..|||.|
Zfish   130 AIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHG 194

  Fly   188 EIKSEQNWIDVVRPIIEKRMQRYSDGE----IHFNLMALISDRQRIYEQQIEKLLNPAPNAMDTE 248
            ....::.|.|..|.:|.:|:...:.||    |.|||||::.||:..||.:::.|          :
Zfish   195 PWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYESKLDIL----------K 249

  Fly   249 EDRQAEISSLRTYIEYEIQKKK 270
            .:||..:..|:     :|::||
Zfish   250 RNRQIILEGLQ-----QIREKK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5NP_001261632.1 Peptidase_C12_UCH37_BAP1 8..222 CDD:187738 96/232 (41%)
bap1NP_001157309.1 Peptidase_C12_UCH37_BAP1 5..233 CDD:187738 96/232 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..354
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..415
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..535
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 593..652
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 729..755
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q92560 743..748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2778
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1363547at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.