DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uch-L5 and Uch

DIOPT Version :9

Sequence 1:NP_001261632.1 Gene:Uch-L5 / 39102 FlyBaseID:FBgn0011327 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001188681.1 Gene:Uch / 33397 FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster


Alignment Length:239 Identity:62/239 - (25%)
Similarity:105/239 - (43%) Gaps:34/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WCLIESDPGVFTELIREFGCDGA-QVEEIWSLDSESFKNL-EPIHGLIFLF-------------- 56
            |..:||:|.|.|:.|.:.|...| .|.::..|:.::.:.: .|:...|.||              
  Fly     4 WTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEH 68

  Fly    57 ---KWVQEDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQC 118
               |.|:|..|        |::|:.:|..:|||.|.|::..:.|....||..| .|.:|.|....
  Fly    69 DRIKEVEEQHP--------EDLFYMRQFTHNACGTVALIHSVANNKEVDIDRG-VLKDFLEKTAS 124

  Fly   119 FDPYNKGLTLSNASQIRTVHNSFARPTLFELDTKNQKKDDDVYHFVGYMPIGGRLYELDGLREGP 183
            ..|..:|..|....:....|.:.|:    |..|.....:..::||:..:...|.||||||.:..|
  Fly   125 LSPEERGRALEKDEKFTADHEALAQ----EGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFP 185

  Fly   184 IDLGEIKSEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQ 227
            |..|. .||:.::.....:.::.|.| ...|:.|.::||.:.:|
  Fly   186 IKHGP-TSEETFVKDAAKVCKEFMAR-DPNEVRFTVLALTAAQQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uch-L5NP_001261632.1 Peptidase_C12_UCH37_BAP1 8..222 CDD:187738 59/232 (25%)
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10589
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.