DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHOG and Rac1

DIOPT Version :9

Sequence 1:NP_001656.2 Gene:RHOG / 391 HGNCID:672 Length:191 Species:Homo sapiens
Sequence 2:NP_001261247.1 Gene:Rac1 / 38146 FlyBaseID:FBgn0010333 Length:192 Species:Drosophila melanogaster


Alignment Length:193 Identity:131/193 - (67%)
Similarity:154/193 - (79%) Gaps:3/193 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYD 65
            ||:||||||||||||||||||.|||||||.||||||||||||...||.:.:||.||||||||:||
  Fly     1 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYD 65

Human    66 RLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLK 130
            |||.||||||:||:||||:.:|.|:||||.||:|||.||||..||:|||||.|||...:|:.:|:
  Fly    66 RLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLR 130

Human   131 EQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT--PIKRGRSCILL 191
            ::..||||..||.|:||:|.||:|||||||.|.|:|.||.||:|:||.|.  | |..|.|.||
  Fly   131 DKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQP-KSKRKCALL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHOGNP_001656.2 RhoG 1..191 CDD:133277 129/191 (68%)
Effector region. /evidence=ECO:0000255 32..40 7/7 (100%)
Rac1NP_001261247.1 Rac1_like 3..176 CDD:206663 120/172 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 1 1.000 - - FOG0000070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X103
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.