DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3437 and SAC3B

DIOPT Version :9

Sequence 1:NP_648318.2 Gene:CG3437 / 39096 FlyBaseID:FBgn0035998 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_187280.3 Gene:SAC3B / 819803 AraportID:AT3G06290 Length:1697 Species:Arabidopsis thaliana


Alignment Length:370 Identity:81/370 - (21%)
Similarity:148/370 - (40%) Gaps:64/370 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GSCESFCPDGEAKMRIREKLLHYFELKNGQKNK--PGVLVKEFTRSA---ADVKMPMPKEMRTEA 65
            |.|...||:.|...|.|:..|.::|..:|.:|:  ..:.||::||:|   |.:..|||       
plant   483 GVCPDMCPESERGERERKGDLDHYERVDGDRNQTSKSLAVKKYTRTAEREAILIRPMP------- 540

  Fly    66 ALTKTVEYLLKDIILDTRKPYNV----AYDFIFDRLRAVRREIVIQMYDASQKICLLEPIVMFLA 126
            .|..|:||||.  :||  :|||.    .|:|::||:||:|.::.:|.....:.|.|||.::....
plant   541 ILQNTMEYLLS--LLD--RPYNENFLGMYNFLWDRMRAIRMDLRMQHIFNQEAITLLEQMIRLHI 601

  Fly   127 YSRYRLCEEP-----IEKFDLKICNQHLQECLTGVLCCYEELEDLESSREPTVRELERRCFIESL 186
            .:.:.|||..     .|.||..:..:.:.:....:...|:: ...:....||.:|      ....
plant   602 IAMHELCEYTKGEGFSEGFDAHLNIEQMNKTSVELFQMYDD-HRKKGITVPTEKE------FRGY 659

  Fly   187 YQLFNLG---------SPESFTRALTLPDYVRRDATFKLCFGICLAFQQGN---LYRVLMGVPQL 239
            |.|..|.         |..|...|...|: :|:.:.......:..|.:.||   .:|:......|
plant   660 YALLKLDKHPGYKVEPSELSLDLANMTPE-IRQTSEVLFARNVARACRTGNFIAFFRLARKASYL 723

  Fly   240 PHILCAVAAAKLQVIRRSLLQIFTHAYNNKQLT--VPVPYLLRLLLFDGPTGLQDQ-----CRHY 297
            ...|.....:||:.      |.....::..|:.  :||..:...:      |::::     ..::
plant   724 QACLMHAHFSKLRT------QALASLHSGLQINQGLPVSDMSNWI------GMEEEDIEALLEYH 776

  Fly   298 NISLTADRKAVQFNKTDFNHNAEVFTPQHERFVESKLKRIYIPEV 342
            ..|:....:........|.|..:.:..:..:.|..|..|..:.:|
plant   777 GFSIKVFEEPYMVKNDLFLHADKDYKTKCSKLVHMKKSRTIVEDV 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3437NP_648318.2 SAC3_GANP 56..284 CDD:281402 56/250 (22%)
SAC3BNP_187280.3 SAC3 444..>927 CDD:227411 81/370 (22%)
SAC3_GANP 536..763 CDD:281402 56/257 (22%)
MCM3AP_GANP 1119..>1458 CDD:293374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5079
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12436
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.