DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3437 and mcm3ap

DIOPT Version :9

Sequence 1:NP_648318.2 Gene:CG3437 / 39096 FlyBaseID:FBgn0035998 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_005167925.1 Gene:mcm3ap / 436589 ZFINID:ZDB-GENE-040715-1 Length:2118 Species:Danio rerio


Alignment Length:344 Identity:81/344 - (23%)
Similarity:148/344 - (43%) Gaps:18/344 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GSCESFCPDGEAKMRIREKLLHYFE-LKNGQKNKPGVLVKEFTRSAADVKMPMPKEMRTEAALTK 69
            |:|...||:.|..||.....|..|| :.:.:|......:||::||:||.:.|:|.|:|....|:.
Zfish   687 GTCPDMCPEKERYMRETRNQLSVFEVVPDTEKVDHYAAIKEYSRSSADQEEPLPHELRPLPVLSM 751

  Fly    70 TVEYLLKDIILDTRKPYNVAYDFIFDRLRAVRREIVIQMYDASQKICLLEPIVMFLAYSRYRLCE 134
            |::||:..|:..........|||:::|.|.:|::|..|.....:.:.|:|....|..:..:.||:
Zfish   752 TMDYLVTQIMDQGEGNCRDWYDFVWNRTRGIRKDITQQHLCDPETVSLIEKCTRFHIHCAHHLCQ 816

  Fly   135 EPIEKFDLKICNQHLQECLTGVLCCYEEL--EDLESSREPTVRELERRCFIESLYQLFNLGSPES 197
            ||:..||.||.|:::.:||..:...|::|  :::...:|...|:..         .|..|...:.
Zfish   817 EPMMSFDAKINNENMTKCLQSLKEMYQDLATKEVYCPKEAEFRQYN---------VLVKLNDGDI 872

  Fly   198 FTRALTLPDYVRRDATFKLCFGICLAFQQGNLYRVLMGVPQLPHILCAVAAAKLQVIRRSLLQIF 262
            ..........:|..........:..|....|..|....|....::...:.......:||..|:|.
Zfish   873 LREVQQFRKEIRESPEVTFAVQVFAALNSNNFVRFFKLVSAASYLSSCILHRYFNQVRRQALKIL 937

  Fly   263 THAY---NNKQLTVPVPYLLRLLLFDGPTGLQDQCRHYNISLTADRKAVQFNKTDFNHNAEVFTP 324
            ..|:   :.:....||...:|:|:|...|...:..:.|  .||.....|:.::|.: ...:...|
Zfish   938 NVAFTVGSQRSTIFPVEDFVRMLMFRNATEATEFIQQY--GLTVSDGMVELSRTAY-QEPDYSLP 999

  Fly   325 QHERFVESKLKRIYIPEVL 343
            |.:.....|.:.:.|.||:
Zfish  1000 QKKSVAIEKKRTVLIGEVV 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3437NP_648318.2 SAC3_GANP 56..284 CDD:281402 51/232 (22%)
mcm3apXP_005167925.1 NupH_GANP 2..310 CDD:293373
Nucleoporin_FG 3..81 CDD:290362
RRM_MCM3A_like 481..553 CDD:240889
SAC3_GANP 738..962 CDD:281402 51/232 (22%)
CID_GANP 1226..1294 CDD:293371
MCM3AP_GANP 1324..2114 CDD:293374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5079
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1280
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.