DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3437 and Mcm3ap

DIOPT Version :9

Sequence 1:NP_648318.2 Gene:CG3437 / 39096 FlyBaseID:FBgn0035998 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_006256355.1 Gene:Mcm3ap / 294339 RGDID:1306834 Length:1975 Species:Rattus norvegicus


Alignment Length:352 Identity:88/352 - (25%)
Similarity:151/352 - (42%) Gaps:34/352 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GSCESFCPDGEAKMRIREKLLHYFELKNG-QKNKPGVLVKEFTRSAADVKMPMPKEMRTEAALTK 69
            |:|...||:.|..:|.....|..||:..| .:......|||::||:||.:.|:|.|:|..|.|::
  Rat   633 GTCPDMCPEKERYLRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPSAVLSR 697

  Fly    70 TVEYLLKDIILDTRKPYNVAYDFIFDRLRAVRREIVIQMYDASQKICLLEPIVMFLAYSRYRLCE 134
            |::||:..|:..........|||:::|.|.:|::|..|.......:.|:|....|..:..:.:||
  Rat   698 TMDYLVTQIMDQKEGSLRDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCE 762

  Fly   135 EPIEKFDLKICNQHLQECLTGVLCCYEELEDLESSREPTVRELERRCFIESLYQ----LFNLGSP 195
            ||:..||.||.|:::.:||..:...|::|           |.....|..|:.:|    |.||...
  Rat   763 EPMSSFDAKINNENMTKCLQSLKEMYQDL-----------RNKGVFCASEAEFQGYNVLLNLNKG 816

  Fly   196 ESFTRALTLPDYVRRDATFKLCFGICLAFQQGNLYRVLMGVPQLPHILCAVAAAKLQVIRRSLLQ 260
            :...........||.............|....|..|....|....::...:.......||:..|:
  Rat   817 DILREVQQFHPDVRNSPEVDFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFNQIRKDALR 881

  Fly   261 IFTHAY--NNKQLTV-PVPYLLRLLLFDGPTGLQDQCR------HYNISLTADRKAVQFNKTDFN 316
            ....||  :.::.|| |:..::|:|||       ..|.      :|: .||.....|:.|::.|.
  Rat   882 ALNVAYTVSTQRSTVFPLDGVVRMLLF-------RDCEEATSFLNYH-GLTVADGCVELNRSAFL 938

  Fly   317 HNAEVFTPQHERFVESKLKRIYIPEVL 343
            ....::..:...|:..|| .:.:.||:
  Rat   939 EPEGLYKARKSVFIGRKL-TVSVGEVV 964

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3437NP_648318.2 SAC3_GANP 56..284 CDD:281402 57/234 (24%)
Mcm3apXP_006256355.1 NupH_GANP 2..289 CDD:293373
Nucleoporin_FG 2..95 CDD:290362
RRM_MCM3A_like 433..501 CDD:240889
SAC3_GANP 684..908 CDD:281402 57/234 (24%)
CID_GANP 1162..1231 CDD:293371
MCM3AP_GANP 1259..1971 CDD:293374
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5079
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.