DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3437 and F20D12.2

DIOPT Version :9

Sequence 1:NP_648318.2 Gene:CG3437 / 39096 FlyBaseID:FBgn0035998 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_501328.1 Gene:F20D12.2 / 177589 WormBaseID:WBGene00017642 Length:1116 Species:Caenorhabditis elegans


Alignment Length:302 Identity:75/302 - (24%)
Similarity:138/302 - (45%) Gaps:18/302 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CESFCPDGEAKMRIREKLLHYFE--LKNGQKNKPGVLVKEFTRSAADVKMPMPKEMRTEAALTKT 70
            ||..|.:.|...||.:|.:..:|  :.:|..:.. ::||::.|||||.:.|:|.|:|:|..:.:|
 Worm   291 CEEMCTEKERYQRIVQKGVSPYECDIVSGDVSHE-MMVKQYARSAADQERPLPHELRSEKIMNQT 354

  Fly    71 VEYLLKDII---LDTRKPYNVAYDFIFDRLRAVRREIVIQMYDASQKICLLEPIVMFLAYSRYRL 132
            ..|||.:::   .|:.......|:|:::|.||:|:|:.......:..:.|:|..........|.|
 Worm   355 TCYLLHNVLDDFPDSADQRGAWYNFLWNRTRALRKEVTQLSLSDTLALNLVERCTRLHILFGYVL 419

  Fly   133 CEEPIEKFDLKICNQHLQECLTGVLCCYEELE--DLESSREPTVRELERRCFIESLYQLFNLGSP 195
            |:..:|:||..:.|:.|.:||..:...||:.|  .:....||..|..:         .:.::...
 Worm   420 CDLGVEQFDPAMNNETLGKCLQTLRHLYEDFEKRGISCENEPEFRSYD---------VMLHMNDT 475

  Fly   196 ESFTRALTLPDYVRRDATFKLCFGICLAFQQGNLYRVL-MGVPQLPHILCAVAAAKLQVIRRSLL 259
            ....:.|.....||:....:|...:..||:..|.:|.. :...|..::.|.||.....|.|.:.:
 Worm   476 NVLAQVLAYRSEVRQSQPVRLALQLATAFRDNNYFRFFRLLQTQASYLQCCVAHKLFAVTRSNAI 540

  Fly   260 QIFTHAYNNKQLTVPVPYLLRLLLFDGPTGLQDQCRHYNISL 301
            :|.:.:|....:..|:..|.|:|.||....|......|.:.:
 Worm   541 RIMSISYGIGNIPYPLDKLQRILGFDNTEDLTVMLNIYELEI 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3437NP_648318.2 SAC3_GANP 56..284 CDD:281402 55/233 (24%)
F20D12.2NP_501328.1 SAC3_GANP 291..582 CDD:367477 75/300 (25%)
SPFH_like <687..788 CDD:388510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5079
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1280
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.