DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phol and YY2

DIOPT Version :9

Sequence 1:NP_001287005.1 Gene:phol / 39095 FlyBaseID:FBgn0035997 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_996806.2 Gene:YY2 / 404281 HGNCID:31684 Length:372 Species:Homo sapiens


Alignment Length:511 Identity:137/511 - (26%)
Similarity:198/511 - (38%) Gaps:221/511 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PPPIIMQQ--------TSDDEEFIEEDGQQMTSSCDGD----GDEDDEATAPAT--TNAFEIASE 180
            ||.:::|.        ..|.|..:.:..:::...||.|    .|.:|:...|.:  ...|::...
Human    57 PPLMVLQPLFTNTGYGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTLA 121

  Fly   181 MLTTIEATNIKEEQLESDFYMKATEDSNSSNGQLQDFKLFGSSRVE---RPMGNSAA---KRWKQ 239
            .|:...|               :|..|..|..:....|..|.|...   .|.|:|::   ::|:|
Human   122 SLSASAA---------------STSTSTQSRSKKPSKKPSGKSATSTEANPAGSSSSLGTRKWEQ 171

  Fly   240 TKVPIRITQDEFNVTLWSSLNSEDEDE--EEELEEPPGCAGTTSVTSSSAAQNEGSPSMPKLIID 302
            .::.::..:.||:||:||..::.|:..  |.:.|.||..                          
Human   172 KQMQVKTLEGEFSVTMWSPNDNNDQGAVGEGQAENPPDY-------------------------- 210

  Fly   303 EHMINHDVLSDGIGNEYVILPDPFSASAVTDVEEVVNAFMGDVKGEEDSQPLSEQLIYAENQLEE 367
                          :||                         :||::                  
Human   211 --------------SEY-------------------------LKGKK------------------ 218

  Fly   368 AYGNIELIENMPNNVELIQTPGPGPATVSVALSKVNGCVPNPQPALPKLVLQNSSTNVRLKSAGN 432
                      :|          ||                    .||.:.|.:            
Human   219 ----------LP----------PG--------------------GLPGIDLSD------------ 231

  Fly   433 QSKVTKRQLTAAAQVATPNPPPPLVASSNPARPQRPTIVTKLPTAVANQTAGNAMGAAGAAGEED 497
                                 |..:|.....:|:|                           .:.
Human   232 ---------------------PKQLAEFTKVKPKR---------------------------SKG 248

  Fly   498 EEPK-FRCTHRGCNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFEC 561
            |.|| ..|::.||.|.||:::|||||:|.||||.|||..|||:|:|||||:||||||||||||:|
Human   249 EPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGPRVHVCAECGKAFLESSKLRRHQLVHTGEKPFQC 313

  Fly   562 TFEGCGKRFSLDFNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTKPK 617
            ||||||||||||||||||:||||||:|:.||.|.|::.||||||||:|:|||.|.|
Human   314 TFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNRKFAQSTNLKTHILTHVKTK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pholNP_001287005.1 zf-C2H2 502..526 CDD:278523 12/23 (52%)
COG5048 <504..614 CDD:227381 81/109 (74%)
C2H2 Zn finger 504..526 CDD:275368 12/21 (57%)
zf-C2H2 531..553 CDD:278523 16/21 (76%)
C2H2 Zn finger 533..553 CDD:275368 14/19 (74%)
zf-H2C2_2 546..571 CDD:290200 22/24 (92%)
C2H2 Zn finger 561..583 CDD:275368 20/21 (95%)
zf-H2C2_2 575..602 CDD:290200 17/26 (65%)
C2H2 Zn finger 591..613 CDD:275368 14/21 (67%)
YY2NP_996806.2 Mediates transcriptional activation 32..102 9/44 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..172 11/60 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..210 8/23 (35%)
Mediates transcriptional repression 237..372 89/160 (56%)
zf-C2H2_8 255..334 CDD:292531 59/78 (76%)
C2H2 Zn finger 256..278 CDD:275368 12/21 (57%)
C2H2 Zn finger 285..305 CDD:275368 14/19 (74%)
zf-H2C2_2 298..323 CDD:290200 22/24 (92%)
COG5048 <309..>372 CDD:227381 47/61 (77%)
C2H2 Zn finger 313..335 CDD:275368 20/21 (95%)
zf-H2C2_2 327..354 CDD:290200 17/26 (65%)
C2H2 Zn finger 343..365 CDD:275368 14/21 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157908
Domainoid 1 1.000 84 1.000 Domainoid score I8245
eggNOG 1 0.900 - - E33208_3BEPX
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D362296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.