DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phol and ZFP42

DIOPT Version :9

Sequence 1:NP_001287005.1 Gene:phol / 39095 FlyBaseID:FBgn0035997 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001291287.1 Gene:ZFP42 / 132625 HGNCID:30949 Length:310 Species:Homo sapiens


Alignment Length:175 Identity:86/175 - (49%)
Similarity:106/175 - (60%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 PQRPTIVTKLPTAVANQTAGNAMGAAGAAGEEDEEPK---------------------FRCTHRG 508
            ||:  ||.:.....:....|..:...|..|.:..:||                     ..|...|
Human   132 PQK--IVGENSLEYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARKKPPINKEYDSLSAIACPQSG 194

  Fly   509 CNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFECTFEGCGKRFSLD 573
            |.::.||.:|:|||:..||||.|||..|||:||||||||||.|||||||||.|||||||||||||
Human   195 CTRKLRNRAALRKHLLIHGPRDHVCAECGKAFVESSKLKRHFLVHTGEKPFRCTFEGCGKRFSLD 259

  Fly   574 FNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTKPKR 618
            ||||||||||||::.:.||..||::.|.||.|||:|:|||....:
Human   260 FNLRTHVRIHTGEKRFVCPFQGCNRRFIQSNNLKAHILTHANTNK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pholNP_001287005.1 zf-C2H2 502..526 CDD:278523 9/23 (39%)
COG5048 <504..614 CDD:227381 76/109 (70%)
C2H2 Zn finger 504..526 CDD:275368 9/21 (43%)
zf-C2H2 531..553 CDD:278523 17/21 (81%)
C2H2 Zn finger 533..553 CDD:275368 15/19 (79%)
zf-H2C2_2 546..571 CDD:290200 22/24 (92%)
C2H2 Zn finger 561..583 CDD:275368 21/21 (100%)
zf-H2C2_2 575..602 CDD:290200 16/26 (62%)
C2H2 Zn finger 591..613 CDD:275368 12/21 (57%)
ZFP42NP_001291287.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
C2H2 Zn finger 190..212 CDD:275368 9/21 (43%)
COG5048 214..>307 CDD:227381 66/91 (73%)
C2H2 Zn finger 219..239 CDD:275368 15/19 (79%)
zf-H2C2_2 232..257 CDD:290200 22/24 (92%)
C2H2 Zn finger 247..269 CDD:275368 21/21 (100%)
zf-H2C2_2 261..288 CDD:290200 16/26 (62%)
C2H2 Zn finger 277..299 CDD:275368 12/21 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157907
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D362296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.