DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phol and Yy2

DIOPT Version :9

Sequence 1:NP_001287005.1 Gene:phol / 39095 FlyBaseID:FBgn0035997 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001092193.1 Gene:Yy2 / 100073351 MGIID:3837947 Length:378 Species:Mus musculus


Alignment Length:497 Identity:152/497 - (30%)
Similarity:204/497 - (41%) Gaps:185/497 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 TNAFEIASEMLTTIEATNIKEEQLESDFYMKATEDSNSSNGQLQDFKLFGSSRVERPMGNSAAKR 236
            |.:.||.::.:..:...||.:.:..|         ..:|.|  |..:::|...|:...|:     
Mouse    13 TESAEIPADFVELLPPDNIGDIEAVS---------LETSVG--QTIEVYGDVGVDWAHGS----- 61

  Fly   237 WKQTKVPIRITQDEFNVTLWSSLNSEDEDE--------EEE----------LEEP---------- 273
              |...|:...|.    .:.|||:|.|.|:        |||          |..|          
Mouse    62 --QYHSPVIALQP----LVGSSLSSRDHDKEMFVVQTREEEVVGYQDSDNLLFSPEFGSQMVLPV 120

  Fly   274 -------PGCAGTTSVTSSSAAQNEGSPSMPKL-----IID---EHMINHDV--------LSDGI 315
                   |..|..|...::...|.|.||....|     .|:   |..:|.|:        ..||:
Mouse   121 NEDDYLQPTTASFTGFLAAENGQGELSPYEGNLCGLTTFIEAGAEESVNADLGDKQWEQKQIDGL 185

  Fly   316 GNEYVILPDPFSASAVTDVEEVVNAFMGDVKGEEDSQPLSEQLIYAENQLEEAYGNIELIENMPN 380
            ..|:     ||:             ...||..:||  |::|         |:|            
Mouse   186 DGEF-----PFT-------------MWDDVNEKED--PIAE---------EQA------------ 209

  Fly   381 NVELIQTPGPGPATVSVALSKVNGCVPNPQPALPKLVLQNSSTNVRLKSAGNQSKVTKRQLTAAA 445
                    |..|...|..::...    .|...:|.:.|.:                         
Mouse   210 --------GESPPDYSEYMTGKK----FPPEGIPGIDLSD------------------------- 237

  Fly   446 QVATPNPPPPLVASSNPARPQRPTIVTKLPTAVANQTAGNAMGAAGAAGEEDEEPKFRCTHRGCN 510
                    |..:|.....||::|.  ...|..:|                        |:|:||.
Mouse   238 --------PKQLAEFTSMRPKKPK--GDFPRPIA------------------------CSHKGCE 268

  Fly   511 KEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFECTFEGCGKRFSLDFN 575
            |.|:::||||||:|.||||.|||..|||:|||||||||||||||||||::|||||||:|||||||
Mouse   269 KMFKDNSAMRKHLHIHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPYQCTFEGCGRRFSLDFN 333

  Fly   576 LRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTKPK 617
            |||||||||||:|:.||.|.|:|.||||||||||:|||.|.|
Mouse   334 LRTHVRIHTGDKPFVCPFDACNKKFAQSTNLKSHILTHVKNK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pholNP_001287005.1 zf-C2H2 502..526 CDD:278523 13/23 (57%)
COG5048 <504..614 CDD:227381 85/109 (78%)
C2H2 Zn finger 504..526 CDD:275368 13/21 (62%)
zf-C2H2 531..553 CDD:278523 18/21 (86%)
C2H2 Zn finger 533..553 CDD:275368 16/19 (84%)
zf-H2C2_2 546..571 CDD:290200 21/24 (88%)
C2H2 Zn finger 561..583 CDD:275368 20/21 (95%)
zf-H2C2_2 575..602 CDD:290200 19/26 (73%)
C2H2 Zn finger 591..613 CDD:275368 16/21 (76%)
Yy2NP_001092193.1 Mediates transcriptional activation. /evidence=ECO:0000250 39..113 20/86 (23%)
Mediates transcriptional repression. /evidence=ECO:0000250 243..378 93/159 (58%)
C2H2 Zn finger 265..284 CDD:275368 11/18 (61%)
COG5048 <289..378 CDD:227381 71/87 (82%)
zf-C2H2 289..311 CDD:278523 18/21 (86%)
C2H2 Zn finger 291..311 CDD:275368 16/19 (84%)
zf-H2C2_2 304..329 CDD:290200 21/24 (88%)
C2H2 Zn finger 319..341 CDD:275368 20/21 (95%)
zf-H2C2_2 333..360 CDD:290200 19/26 (73%)
C2H2 Zn finger 349..371 CDD:275368 16/21 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BEPX
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D362296at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.