DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3448 and AT1G61410

DIOPT Version :9

Sequence 1:NP_648316.1 Gene:CG3448 / 39094 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_564776.1 Gene:AT1G61410 / 842435 AraportID:AT1G61410 Length:118 Species:Arabidopsis thaliana


Alignment Length:103 Identity:27/103 - (26%)
Similarity:48/103 - (46%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LDAAIEAGQQ---KPQAAPATESDAQTTASLAEYEKYVRDSKLKEEELLKKFLLLLNSKKAH--- 188
            ::|.|...::   |.::....:|:|:  ..||:.||...:....|.....|||.:||:|||.   
plant     1 MEANIRLSEEVVNKTRSFEKMKSEAE--RCLAQGEKLCDEKTEFENATYAKFLSVLNAKKAKLRA 63

  Fly   189 IRDLESQLE--KRSGKVSRAKNNQRIFSDDEDDAYGAA 224
            :||.|..:.  :......:|::.:...||||.....|:
plant    64 VRDKEDSVRAVEEEESTYKAESFESGRSDDEQSGEEAS 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
AT1G61410NP_564776.1 XRCC4 <19..>101 CDD:369011 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28PWP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.