DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3448 and XRCC4

DIOPT Version :9

Sequence 1:NP_648316.1 Gene:CG3448 / 39094 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001154639.1 Gene:XRCC4 / 821885 AraportID:AT3G23100 Length:264 Species:Arabidopsis thaliana


Alignment Length:257 Identity:55/257 - (21%)
Similarity:104/257 - (40%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STFVVKLLQRSQLSHS----QIDVKPFIYVRSKWMDDDVEFDILTTSDNQNYRSIVKYDEFRSGA 62
            :||:..:::..:..|:    :|.....|:|:..|.:.  .|||..|..:.::......:|....|
plant    11 TTFIETMVESEKTKHTCLRLEISGADPIFVKGTWHNS--RFDISVTDGSSSWICNATEEEVAERA 73

  Fly    63 SELEQAYDAFFAECKSAVTTHMGLQGFDYEISMEDV-----------EKPAFKV---YKCEGYET 113
            ::.:|.    .:|.......::|.|..:...|..|.           ||...|:   :||:..: 
plant    74 AQWDQP----VSEYLKLAEQYLGFQQPNSVYSFSDALEGSKRLSWTFEKEGTKLEWRWKCKPSD- 133

  Fly   114 LYLDVPLRKVSNCYQMLDAAIEAG-------QQKPQAAPATESDAQTTASLAEYEKYVRDSKLKE 171
                 ..:|::  ..:||..:||.       ..|.::.....|:|:  ..||:.||...:....|
plant   134 -----DSKKIT--VGILDFLMEANIRLSEEVVNKTRSFEKMRSEAE--RCLAQGEKLCDEKTEFE 189

  Fly   172 EELLKKFLLLLNSKKAHIRDLES-----QLEKRSGKVSRAKNNQRIFSDD---EDDAYGAAT 225
            .....|||.:||:|||.:|.|..     ::.:......:|::.:...|||   |::|...||
plant   190 SATYAKFLSVLNAKKAKLRALRDKEDSVRVVEEEESTDKAESFESGRSDDEKSEEEASKKAT 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
XRCC4NP_001154639.1 XRCC4 47..>256 CDD:284132 48/221 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28PWP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28559
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.