DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3448 and xrcc4

DIOPT Version :9

Sequence 1:NP_648316.1 Gene:CG3448 / 39094 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_009303957.1 Gene:xrcc4 / 393759 ZFINID:ZDB-GENE-040426-1755 Length:358 Species:Danio rerio


Alignment Length:251 Identity:55/251 - (21%)
Similarity:103/251 - (41%) Gaps:42/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLSHSQIDVKPFIYVRSKWMDD-DVEFDILTTSDNQNYRSIVKYDEFRSGASELEQAYDAFFAEC 76
            |:|.|....:.| :::.:|.:| ...|.|........:...|..::....|.|:|...|.:..:.
Zfish    11 QISISSEPQRCF-FLKLEWAEDLGSGFVIFLCDGESAWSGEVSEEDVSREAREMEMERDRYVCDL 74

  Fly    77 KSAVTTHMGLQG------FDYEISMEDVEKPAFKVYKCEGYETLYLD-------VPLRKVSNCYQ 128
            :.|:|......|      |.::::.|...:|..::    .||.:..|       |.|:.|....:
Zfish    75 QLALTGAPSGSGASDEGEFTFQLTPERPGRPQLQL----SYEKVQKDISFRLGVVDLQPVPEPTE 135

  Fly   129 MLDAAIEAG-QQKPQAAPATESDAQTTASL--------AEYEKYVRDSKLKEEELLKKFLLLLNS 184
            ::...|..| :|..:...:.:...:....|        .|.|:||:..:..|.:|..:|:|:||.
Zfish   136 VIRELITHGLEQSSRLQASNQHLLEENQKLRREQQHITEEMERYVKGKEALERDLYSRFVLVLNE 200

  Fly   185 KKA-------HIRDLESQLEKRSGKVSRAKNNQRIF-------SDDEDDAYGAATQ 226
            |||       .:|:||...|:||.:..:|.:.....       |.||:..||.:|:
Zfish   201 KKAKLRALQQRVRELEEAEEERSPRKKKADSEDHEAVEAAADKSPDEESDYGGSTE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
xrcc4XP_009303957.1 XRCC4 6..356 CDD:284132 55/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28PWP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.