DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3448 and Xrcc4

DIOPT Version :9

Sequence 1:NP_648316.1 Gene:CG3448 / 39094 FlyBaseID:FBgn0035996 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_082288.1 Gene:Xrcc4 / 108138 MGIID:1333799 Length:326 Species:Mus musculus


Alignment Length:228 Identity:51/228 - (22%)
Similarity:79/228 - (34%) Gaps:58/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FDILTTSDNQNYRSIVKYDEFRSGASELEQAYDAFFAECKSAVTTHMGLQG------------FD 90
            |.|..|..:..:.:.|...|....|.::......:..|.:.|:....|..|            |.
Mouse    32 FVITLTDGHSAWTATVSELEISQEADDMAMEKGKYIDELRKALVPGSGAAGTYKFLFSKESRHFS 96

  Fly    91 YEISMEDVEKPAFKVYKCEGYETLYLDVPLRKVSN---------CYQMLDAAIEAGQQKPQAAPA 146
            .|..::||   :|::      .:..||    ||||         || .||...|...:.......
Mouse    97 LEKELKDV---SFRL------GSFNLD----KVSNSAEVIRDLICY-CLDTITEKQAKNEHLQKE 147

  Fly   147 TE------SDAQTTASLAEYEKYVRDSKLKEEELLKKFLLLLNSKKAHIRDL-----------ES 194
            .|      :|.|     ..:||.|...:..|.:|.::|:|:||.||..||.|           ||
Mouse   148 NERLLRDWNDVQ-----GRFEKCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNEVQQLEES 207

  Fly   195 QLEKRSGKVS-RAKNNQRIFSDDEDDAYGAATQ 226
            ...:|....| :......::....|:..||..|
Mouse   208 TKPERENPCSDKTPEEHGLYDGSTDEESGAPVQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3448NP_648316.1 None
Xrcc4NP_082288.1 Interaction with IFFO1. /evidence=ECO:0000250|UniProtKB:Q13426 1..212 45/198 (23%)
XRCC4 2..326 CDD:369011 51/228 (22%)
Interaction with LIG4. /evidence=ECO:0000250 180..212 11/31 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..326 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28PWP
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.