DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3529 and Wdfy2

DIOPT Version :10

Sequence 1:NP_648315.1 Gene:CG3529 / 39093 FlyBaseID:FBgn0035995 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster


Alignment Length:61 Identity:13/61 - (21%)
Similarity:29/61 - (47%) Gaps:11/61 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 MLSVLKPGQESPDDY-------ALLNELTSTCKEMQSRIV----DLIGRVQDDELTAEFLR 290
            |.:.:||.|.:.:|.       .||::|..:..::.:.|:    :.:..|.||:....:|:
  Fly     1 MAAEIKPAQRTNNDRFNTSKKPELLSKLEGSSDDVNAAILIPGENGVISVSDDKTVRVWLK 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3529NP_648315.1 VHS_Tom1_like 17..154 CDD:340768
GAT_TOM1_like 222..307 CDD:410581 13/61 (21%)
Wdfy2NP_609400.1 WD40 24..279 CDD:475233 8/38 (21%)
WD40 repeat 35..72 CDD:293791 5/27 (19%)
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.