DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3529 and TOM1L1

DIOPT Version :9

Sequence 1:NP_648315.1 Gene:CG3529 / 39093 FlyBaseID:FBgn0035995 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_005477.2 Gene:TOM1L1 / 10040 HGNCID:11983 Length:476 Species:Homo sapiens


Alignment Length:542 Identity:151/542 - (27%)
Similarity:253/542 - (46%) Gaps:135/542 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FSTPVGQRIEAATDANLASENWAANMEICDMINESSDTARDAMRAIRKRLSQNAGKNNQVVMYTL 78
            ::|.||..||.||.|.:.:|:|...|.|||:||.:.|..:||::|::||:|:|  .|::.:..||
Human    11 YATSVGHLIEKATFAGVQTEDWGQFMHICDIINTTQDGPKDAVKALKKRISKN--YNHKEIQLTL 73

  Fly    79 TVLETCVKNCGKAFHVLVAQKDFINE-LVKLIGPKNDPPAAMQEKVLSLIQIWADAFKNQPDLNG 142
            ::::.||:|||.:|..|:.:|:|:.| ||||:.|:.:.|..:|.::|:.|:.|:..|....|::.
Human    74 SLIDMCVQNCGPSFQSLIVKKEFVKENLVKLLNPRYNLPLDIQNRILNFIKTWSQGFPGGVDVSE 138

  Fly   143 VTQMYMELKNKGIEFPANDLDA------MAPIYT-PQRSVPEMPPQLVAAQQHTISPQHMAAAAA 200
            |.::|::|..||::||.::.:|      .|.|.: |..|||..|                     
Human   139 VKEVYLDLVKKGVQFPPSEAEAETARQETAQISSNPPTSVPTAP--------------------- 182

  Fly   201 AAAAAAAPPSTGPLHLTPEQAAKLRSELEIVSNNMSILSEMLSVLKPGQESPDDYALLNELTSTC 265
             |.::...|....:.|.|||..||.|||::|..|:.::|.:|....||.|:.:|..||.:|..|.
Human   183 -ALSSVIAPKNSTVTLVPEQIGKLHSELDMVKMNVRVMSAILMENTPGSENHEDIELLQKLYKTG 246

  Fly   266 KEMQSRIVDLIGRVQDDELTAEFLRINDELNNVFLRHQRY--------EKNRSQGQGAGVTS-PS 321
            :|||.||:||:..|:::::|.|.:::|::|||..|.::|:        |:|::|.:....|| ||
Human   247 REMQERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPS 311

  Fly   322 AVLGAAMGLPGVGAAGAGATTVATLPPPPTTTAVSNTPQSDQLLIDLIESSEEAQLPQ-SLGQIS 385
            |                                    |..|  |:||   |...::|: :||:::
Human   312 A------------------------------------PSQD--LLDL---SPSPRMPRATLGELN 335

  Fly   386 LGGGAPIGVQRSARPADEFDMLAQSRTDGNHKSDLLRDIPSVDAAAGSVTATASPYKPNQPQQAQ 450
                                      |..|..|.|...:||.|     ||....|....|.....
Human   336 --------------------------TMNNQLSGLNFSLPSSD-----VTNNLKPSLHPQMNLLA 369

  Fly   451 RSAGEPPVVSKSTKENEIDEMEAWLGSSHIEGIEELTSSEFDKFLEERAAA---AENLPTISASN 512
            ....|.|..::.|.:|        |.|||          .:|.|||...:.   ..:|.||:|:.
Human   370 LENTEIPPFAQRTSQN--------LTSSH----------AYDNFLEHSNSVFLQPVSLQTIAAAP 416

  Fly   513 SAASATTGSAGADSLRKTPKKP 534
            |..|.....:...::.|:..:|
Human   417 SNQSLPPLPSNHPAMTKSDLQP 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3529NP_648315.1 VHS_Tom1 17..158 CDD:239623 53/141 (38%)
GAT_TOM1_like 222..307 CDD:260091 33/92 (36%)
TOM1L1NP_005477.2 VHS_Tom1 14..154 CDD:239623 53/141 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..179 5/23 (22%)
GAT_TM1L1 199..290 CDD:260095 36/90 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..327 12/69 (17%)
Interaction with GRB2. /evidence=ECO:0000250 392..395 1/2 (50%)
SH3-binding. /evidence=ECO:0000250 421..425 0/3 (0%)
Interaction with PIK3R1. /evidence=ECO:0000250 442..445
SH2-binding. /evidence=ECO:0000250 460..463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141234
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352228at33208
OrthoFinder 1 1.000 - - FOG0000599
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13856
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X466
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.