DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YA and NF-YA1

DIOPT Version :9

Sequence 1:NP_648313.1 Gene:Nf-YA / 39091 FlyBaseID:FBgn0035993 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001318552.1 Gene:NF-YA1 / 831124 AraportID:AT5G12840 Length:272 Species:Arabidopsis thaliana


Alignment Length:91 Identity:44/91 - (48%)
Similarity:58/91 - (63%) Gaps:9/91 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 EEPLYVNAKQYKRILIRRQARAK--LESRIPKERCKYLHESRHRHAMNRARGEGGRFHSAQE-KG 349
            :||:|||||||:.||.||:||||  ||.::.::|..|||||||:|||.|||..||||....| :.
plant   171 QEPVYVNAKQYEGILRRRKARAKAELERKVIRDRKPYLHESRHKHAMRRARASGGRFAKKSEVEA 235

  Fly   350 DQDSSGPEGGSMPMASSGGVTLSRGT 375
            .:|:.|.:      ...|..|.|.|:
plant   236 GEDAGGRD------RERGSATNSSGS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YANP_648313.1 CBF 286..345 CDD:128795 37/58 (64%)
NF-YA1NP_001318552.1 CBF 169..230 CDD:128795 37/58 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3138
eggNOG 1 0.900 - - E1_COG5224
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001472
OrthoInspector 1 1.000 - - otm2717
orthoMCL 1 0.900 - - OOG6_102402
Panther 1 1.100 - - O PTHR12632
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.860

Return to query results.
Submit another query.