DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YA and NF-YA10

DIOPT Version :9

Sequence 1:NP_648313.1 Gene:Nf-YA / 39091 FlyBaseID:FBgn0035993 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001330575.1 Gene:NF-YA10 / 830539 AraportID:AT5G06510 Length:269 Species:Arabidopsis thaliana


Alignment Length:77 Identity:36/77 - (46%)
Similarity:46/77 - (59%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 KGEADEE-PLYVNAKQYKRILIRRQARAKLESRIPKERCK--YLHESRHRHAMNRARGEGGRFHS 344
            |.|.:|: .:|||:|||..|:.|||:|||.|.   ..||:  |:|.|||.|||.|.||.||||.:
plant   127 KMETEEDGTIYVNSKQYHGIIRRRQSRAKAEK---LSRCRKPYMHHSRHLHAMRRPRGSGGRFLN 188

  Fly   345 AQEKGDQDSSGP 356
            .:.......|.|
plant   189 TKTADAAKQSKP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YANP_648313.1 CBF 286..345 CDD:128795 32/61 (52%)
NF-YA10NP_001330575.1 CBF 132..189 CDD:128795 32/59 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3138
eggNOG 1 0.900 - - E1_COG5224
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2717
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12632
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.960

Return to query results.
Submit another query.