DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YA and NF-YA9

DIOPT Version :10

Sequence 1:NP_648313.1 Gene:Nf-YA / 39091 FlyBaseID:FBgn0035993 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_566670.1 Gene:NF-YA9 / 821640 AraportID:AT3G20910 Length:303 Species:Arabidopsis thaliana


Alignment Length:103 Identity:47/103 - (45%)
Similarity:62/103 - (60%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 EADEEPLYVNAKQYKRILIRRQARAK--LESRIPKERCKYLHESRHRHAMNRARGEGGRF----- 342
            |..:||::||||||:.||.|||||||  ||.::.|.|..|||||||:|||.|.||.||||     
plant   162 EMAQEPVFVNAKQYQAILRRRQARAKAELEKKLIKSRKPYLHESRHQHAMRRPRGTGGRFAKKTN 226

  Fly   343 -HSAQEKGDQDSSGPEGGSMPMASSGGVTLSRGTARAP 379
             .:::.|.::.|:|....|...::|.......|..|.|
plant   227 TEASKRKAEEKSNGHVTQSPSSSNSDQGEAWNGDYRTP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YANP_648313.1 CBF 286..345 CDD:128795 38/66 (58%)
NF-YA9NP_566670.1 CBF 163..224 CDD:128795 38/60 (63%)

Return to query results.
Submit another query.