DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YA and NF-YA2

DIOPT Version :9

Sequence 1:NP_648313.1 Gene:Nf-YA / 39091 FlyBaseID:FBgn0035993 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001327635.1 Gene:NF-YA2 / 819738 AraportID:AT3G05690 Length:332 Species:Arabidopsis thaliana


Alignment Length:157 Identity:48/157 - (30%)
Similarity:67/157 - (42%) Gaps:64/157 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 EADEEPLYVNAKQYKRILIRRQARAK----LESRIPKERCK--YLHESRHRHAMNRARGEGGRFH 343
            |.::..:|||:|||..|:.|||:|||    |:.:....||:  |:|.|||.||:.|.||.||||.
plant   169 ETEDSTIYVNSKQYHGIIRRRQSRAKAAAVLDQKKLSSRCRKPYMHHSRHLHALRRPRGSGGRFL 233

  Fly   344 SAQ-----------EKGD-----------QDSSG-------PEGGSM------------------ 361
            :.:           :|||           |.|:.       ||.|:|                  
plant   234 NTKSQNLENSGTNAKKGDGSMQIQSQPKPQQSNSQNSEVVHPENGTMNLSNGLNVSGSEVTSMNY 298

  Fly   362 ----PMASSGGVTLSRGTARAPPKLIA 384
                |:.|.||:.:       |.|.||
plant   299 FLSSPVHSLGGMVM-------PSKWIA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YANP_648313.1 CBF 286..345 CDD:128795 30/64 (47%)
NF-YA2NP_001327635.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5224
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2717
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12632
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.960

Return to query results.
Submit another query.