DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YA and Nfya

DIOPT Version :9

Sequence 1:NP_648313.1 Gene:Nf-YA / 39091 FlyBaseID:FBgn0035993 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006244471.1 Gene:Nfya / 29508 RGDID:70976 Length:347 Species:Rattus norvegicus


Alignment Length:335 Identity:117/335 - (34%)
Similarity:140/335 - (41%) Gaps:93/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 IGQQPQGQATATGLQ--PQLIPLQANQIM-LQAAQQQPQMQVMQLPDGQTIFYQTPTIAALDPNA 152
            |.||.||..||..||  .|:......|:. ||..|.||.|  :|:..||.|   |.|...:...|
  Rat    22 IQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLM--VQVSGGQLI---TSTGQPIMVQA 81

  Fly   153 AANAAAAMAAQPTPHYLNING----QLVQINPAP----SANQAAPTAGQQ------IIMVPQTAM 203
            ..........|     :.::|    |.:|:.|..    ...||....|||      ||..||||:
  Rat    82 VPGGQGQTIMQ-----VPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAV 141

  Fly   204 AAVNAAAANAGVGAGVGTVVTQQQ-----QQQHQQVQSQTQNQQQQQ------QQQTV------- 250
            .|              |...||||     ||..|..:.||...|...      ||.||       
  Rat   142 TA--------------GQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMIT 192

  Fly   251 --AAVAASAAVNNISADVSTSTTGTNTNSEDESSKGEA--------------------------- 286
              ||..|.|.:....|:.:|:::|..|.:......|..                           
  Rat   193 IPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGA 257

  Fly   287 ---DEEPLYVNAKQYKRILIRRQARAKLES--RIPKERCKYLHESRHRHAMNRARGEGGRFHSAQ 346
               :|||||||||||.|||.|||||||||:  :|||||.||||||||||||.|.|||||||.|.:
  Rat   258 EMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPK 322

  Fly   347 EKGDQDSSGP 356
            ||.......|
  Rat   323 EKDSPHMQDP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YANP_648313.1 CBF 286..345 CDD:128795 48/90 (53%)
NfyaXP_006244471.1 CBFB_NFYA 263..318 CDD:396572 45/54 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353761
Domainoid 1 1.000 92 1.000 Domainoid score I7478
eggNOG 1 0.900 - - E1_COG5224
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4764
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001472
OrthoInspector 1 1.000 - - oto96903
orthoMCL 1 0.900 - - OOG6_102402
Panther 1 1.100 - - LDO PTHR12632
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.