DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nf-YA and php2

DIOPT Version :9

Sequence 1:NP_648313.1 Gene:Nf-YA / 39091 FlyBaseID:FBgn0035993 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_595491.1 Gene:php2 / 2541161 PomBaseID:SPBC725.11c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:129 Identity:52/129 - (40%)
Similarity:67/129 - (51%) Gaps:27/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 EPLYVNAKQYKRILIRRQARAKLESR---IPKERCKYLHESRHRHAMNRARGEGGRFHS------ 344
            |.||||||||.|||.||:||||||.|   :...:..|||||||:|||.|.||.||||.:      
pombe     8 EGLYVNAKQYHRILKRREARAKLEERLRGVQTTKKPYLHESRHKHAMRRPRGPGGRFLTADKVSK 72

  Fly   345 --AQEKGDQDSSGPEGG-----------SMPMASSGGVT-LSRGTARA----PPKLIAPHQTPS 390
              |||..:..::|...|           ::|...|..|| .|.|.|.:    |..:....::|:
pombe    73 LRAQEAAEAAANGGSTGDDVNATNANDATVPATVSSEVTHTSEGYADSNDSRPSSISNSSESPA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nf-YANP_648313.1 CBF 286..345 CDD:128795 38/66 (58%)
php2NP_595491.1 CBFB_NFYA 10..64 CDD:280258 35/53 (66%)
HAP2 84..334 CDD:227549 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I2598
eggNOG 1 0.900 - - E1_COG5224
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001472
OrthoInspector 1 1.000 - - oto101165
orthoMCL 1 0.900 - - OOG6_102402
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R547
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.