DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and AT5G54750

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001190539.1 Gene:AT5G54750 / 835565 AraportID:AT5G54750 Length:199 Species:Arabidopsis thaliana


Alignment Length:187 Identity:74/187 - (39%)
Similarity:120/187 - (64%) Gaps:16/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRLDAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERI-------------GYNMGMRLIED 57
            |.:|  :||:|..||||||:|.|:|.|.|..|:|||||:::             |||:|:|||::
plant    14 SSID--RVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMYSSSTIYVDSLPWGYNIGIRLIDE 76

  Fly    58 FLARTSAPRCLEMRETADRIQQ-AFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFVELPPDLT 121
            |||::...||::.:|||:.|.: .|:::|.:..::::|.......|::.:.|||.:|||||....
plant    77 FLAKSGVSRCVDFKETAEMIAKVGFKMFLGVTASVTSWDSDGTCCSIILEDNPLVDFVELPDTCQ 141

  Fly   122 NLRYSAILSGCIRGALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEEVIPAGED 178
            .|.|..:|||.||||||||.::.:..:.:|.|:||:..||:||.::::.|..|..:|
plant   142 GLYYCNVLSGVIRGALEMVSMKTEVTWTRDVLRGDDAYELQVKLLKQVAEEYPYKDD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 68/166 (41%)
AT5G54750NP_001190539.1 TRAPPC3_bet3 20..187 CDD:271345 68/166 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 131 1.000 Domainoid score I1689
eggNOG 1 0.900 - - E1_KOG3330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6399
Inparanoid 1 1.050 146 1.000 Inparanoid score I1750
OMA 1 1.010 - - QHG54086
OrthoDB 1 1.010 - - D1334804at2759
OrthoFinder 1 1.000 - - FOG0002640
OrthoInspector 1 1.000 - - oto2919
orthoMCL 1 0.900 - - OOG6_102403
Panther 1 1.100 - - LDO PTHR13048
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1739
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.