DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and Trappc3l

DIOPT Version :10

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001156409.1 Gene:Trappc3l / 692132 MGIID:3642034 Length:181 Species:Mus musculus


Alignment Length:40 Identity:11/40 - (27%)
Similarity:21/40 - (52%) Gaps:2/40 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 ESMGVRDFPFLPRFDDESRDARR-YPNHREVLAYIQDFAR 122
            :.|| :.|....|:..:.:||.: :|..::.||...:|.|
Mouse   253 QHMG-KPFEVTNRYLSQLKDAHKSHPFIKDYLAKKNEFDR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 11/40 (28%)
Trappc3lNP_001156409.1 TRAPPC3_bet3 15..170 CDD:271345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.