DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and trappc5

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001002482.1 Gene:trappc5 / 436755 ZFINID:ZDB-GENE-040718-185 Length:188 Species:Danio rerio


Alignment Length:148 Identity:23/148 - (15%)
Similarity:50/148 - (33%) Gaps:41/148 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLARTSAPRCLEMRET--- 73
            :|:.....|.:..:|........:..::..:|..:|..:|..|::..:.|....:    |||   
Zfish    23 EVSVSAFALLFSEMVQYCQSRVYSVSELQARLADMGQGVGASLLDVLVMREKNGK----RETKVL 83

  Fly    74 ------------------ADRIQQAFRIYLNIQPTISNWSPASDEFSLVFDSNPL-TEFVELPPD 119
                              ||:::||               ...|:...:.:..|| ..::.:|.:
Zfish    84 NILLFIKVNVWKALFGKEADKLEQA---------------NDDDKTYYIIEKEPLINAYISVPKE 133

  Fly   120 LTNLRYSAILSGCIRGAL 137
            .:.|..:|...|.:...|
Zfish   134 NSTLNCAAFTGGIVEAIL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 22/146 (15%)
trappc5NP_001002482.1 TRAPPC5_Trs31 24..175 CDD:271346 23/147 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.