DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and Trappc3

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_038746.1 Gene:Trappc3 / 27096 MGIID:1351486 Length:180 Species:Mus musculus


Alignment Length:180 Identity:111/180 - (61%)
Similarity:149/180 - (82%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRQASR-LDAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLARTSA 64
            |||||:| .::||::||..||||||||||:.:|:||.|||||||:|:|||:|:|||||||||::.
Mouse     1 MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDRMGYNIGVRLIEDFLARSNV 65

  Fly    65 PRCLEMRETADRIQQ-AFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFVELPPDLTNLRYSAI 128
            .||.:.|||||.|.: ||::||.|.|:|:|||||.|||||:.::|||.:|||||.:.:.|.||.:
Mouse    66 GRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSALIYSNL 130

  Fly   129 LSGCIRGALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEEVIPAGED 178
            |.|.:||||||||:.|:..||||.||||.|||:|::|:||:|:.:||||:
Mouse   131 LCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 96/153 (63%)
Trappc3NP_038746.1 TRAPPC3_bet3 15..169 CDD:271345 96/153 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836190
Domainoid 1 1.000 190 1.000 Domainoid score I3264
eggNOG 1 0.900 - - E1_KOG3330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6399
Inparanoid 1 1.050 226 1.000 Inparanoid score I3478
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54086
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002640
OrthoInspector 1 1.000 - - oto94988
orthoMCL 1 0.900 - - OOG6_102403
Panther 1 1.100 - - LDO PTHR13048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R136
SonicParanoid 1 1.000 - - X1739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.