DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and TRAPPC3

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001257823.1 Gene:TRAPPC3 / 27095 HGNCID:19942 Length:188 Species:Homo sapiens


Alignment Length:188 Identity:110/188 - (58%)
Similarity:150/188 - (79%) Gaps:10/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRQASR-LDAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERI--------GYNMGMRLIE 56
            |||||:| .::||::||..||||||||||:.:|:||.|||||||::|        |:|:|:||||
Human     1 MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKILFSNFLPRGFNIGVRLIE 65

  Fly    57 DFLARTSAPRCLEMRETADRIQQ-AFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFVELPPDL 120
            |||||::..||.:.|||||.|.: ||::||.|.|:|:|||||.|||||:.::|||.:|||||.:.
Human    66 DFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNH 130

  Fly   121 TNLRYSAILSGCIRGALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEEVIPAGED 178
            ::|.||.:|.|.:||||||||:.|:..||||.||||.|||:|::|:||:|:.:||||:
Human   131 SSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 95/161 (59%)
TRAPPC3NP_001257823.1 TRAPPC3_bet3 15..177 CDD:271345 95/161 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146090
Domainoid 1 1.000 188 1.000 Domainoid score I3316
eggNOG 1 0.900 - - E1_KOG3330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6399
Inparanoid 1 1.050 224 1.000 Inparanoid score I3523
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54086
OrthoDB 1 1.010 - - D1334804at2759
OrthoFinder 1 1.000 - - FOG0002640
OrthoInspector 1 1.000 - - oto91408
orthoMCL 1 0.900 - - OOG6_102403
Panther 1 1.100 - - LDO PTHR13048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R136
SonicParanoid 1 1.000 - - X1739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.