DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and trs31

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_596451.1 Gene:trs31 / 2540014 PomBaseID:SPBC1718.05 Length:209 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:36/137 - (26%)
Similarity:62/137 - (45%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLARTSAPRCLEMRET---- 73
            ||.......:..|:.::.......::..::|...||.:|.:|:|..:.|...|:    |||    
pombe    41 VNLSSFAFIFSELIQRIQSQVSGIQEFEEKLNEHGYRVGQKLVELVVWRERNPK----RETRILG 101

  Fly    74 -ADRIQQAFRIYL--NIQPTISNWSPASDEFSLVFDSNP-LTEFVELPPDLTNLRYSAILSGCIR 134
             ...|..:...||  ....::.....||||:.:| |:|| |.:|:.:|.::..|...|.|:|.|.
pombe   102 ILQYIHSSVWKYLFGKHADSLEKSKEASDEYMIV-DNNPLLNKFISVPKEMNQLNCCAYLAGIIE 165

  Fly   135 GALEMVQ 141
            |.|:..|
pombe   166 GFLDSAQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 35/136 (26%)
trs31NP_596451.1 COG5128 1..209 CDD:227457 36/137 (26%)
TRAPPC5_Trs31 41..198 CDD:271346 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.