DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and trpp-3

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_499100.1 Gene:trpp-3 / 176344 WormBaseID:WBGene00014222 Length:181 Species:Caenorhabditis elegans


Alignment Length:174 Identity:76/174 - (43%)
Similarity:119/174 - (68%) Gaps:8/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLAR-TSAPRCLEMRE 72
            |:||:::|...|||||:||:||:|:|:.:||..||:::|:|||.||.:||||: .:.|||::.|:
 Worm    11 DSKKMSAELFCLTYGAMVTEMLKDYEDPKDVTIQLDKMGFNMGTRLADDFLAKNANVPRCVDTRQ 75

  Fly    73 TADRI-QQAFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFVELPPDLTN--LRYSAILSGCIR 134
            .||.: :.|...||.|..|.|:|:....||::..::|||||.|::|..|.:  |.||.:::|.||
 Worm    76 IADVLCRNAIPCYLGISATASSWTSGDREFTITLEANPLTELVQVPAHLVSAGLSYSQLIAGAIR 140

  Fly   135 GALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEEVIPAGED 178
            ||||.|..:|   :......|.| ||:|::|.:.|::.:|||||
 Worm   141 GALEAVHFKV---YASATDTGAN-TEIRIRFDQVLKDSLPAGED 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 67/156 (43%)
trpp-3NP_499100.1 TRAPPC3_bet3 16..167 CDD:271345 66/154 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158843
Domainoid 1 1.000 120 1.000 Domainoid score I3576
eggNOG 1 0.900 - - E1_KOG3330
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6399
Inparanoid 1 1.050 144 1.000 Inparanoid score I3040
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54086
OrthoDB 1 1.010 - - D1334804at2759
OrthoFinder 1 1.000 - - FOG0002640
OrthoInspector 1 1.000 - - oto19077
orthoMCL 1 0.900 - - OOG6_102403
Panther 1 1.100 - - LDO PTHR13048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R136
SonicParanoid 1 1.000 - - X1739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.