DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and AgaP_AGAP012080

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_320447.4 Gene:AgaP_AGAP012080 / 1280593 VectorBaseID:AGAP012080 Length:192 Species:Anopheles gambiae


Alignment Length:183 Identity:39/183 - (21%)
Similarity:68/183 - (37%) Gaps:38/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QASRLDAK------KVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLART 62
            :||.||..      :|:.....|.:..||...........|:..:|..:|.::|.|:|:.:..|.
Mosquito    13 KASILDKPLSRGKGEVSLSSYALLFSELVQYSQSRVSTIPDLQTRLHDMGKDVGCRIIDLYFVRE 77

  Fly    63 SAPRCLEMRETADRIQQAFRIYLNIQPTISNWS------------PASDEFS-LVFDSNPL-TEF 113
            ...:    |||     :...:.|.|:.|:  |.            ...||.: .:.:..|| .:|
Mosquito    78 RNSK----RET-----KLINMLLFIKTTL--WKTLFGKEADKLEHATDDECTYYIIEKEPLVNKF 131

  Fly   114 VELPPDLTNLRYSAILSGCIRGALEMVQLEVQCWFV-QDQLKGDNVTELRVKF 165
            :.:|.|..:|..:..::|.::..|.      .|.|. |........|...|||
Mosquito   132 ISVPKDKGSLNCAVFVAGIVQAVLS------NCGFTCQVSAHWHKGTTYMVKF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 34/167 (20%)
AgaP_AGAP012080XP_320447.4 TRAPPC5_Trs31 28..179 CDD:271346 35/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.