DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and trappc3l

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_031758513.1 Gene:trappc3l / 101731069 XenbaseID:XB-GENE-6032822 Length:197 Species:Xenopus tropicalis


Alignment Length:169 Identity:78/169 - (46%)
Similarity:114/169 - (67%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ASRLDAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLARTSAPRCLE 69
            :|...|..::.:...|:|||||.|:.:|:|..|||||.|:.:|||:|:||||||||.|...:|..
 Frog    22 SSSASAHHISRDLFVLSYGALVAQLCKDYERDEDVNKYLDAMGYNIGIRLIEDFLANTGIKKCRN 86

  Fly    70 MRETADRIQQ-AFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFV-ELPPDLTNLRYSAILSGC 132
            ..||.|.|.: ||::||.|.||:...:...:.|||:.|:|||.::| |||...::|.|..:|||.
 Frog    87 YNETVDVIAKVAFKMYLGITPTMIGGNDGGNGFSLILDTNPLDDYVEELPSGRSSLSYCNLLSGI 151

  Fly   133 IRGALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEE 171
            |||||||:.|.....|:||:|:||:|||:.:.|:|:.:|
 Frog   152 IRGALEMIHLPADVTFIQDRLRGDDVTEIGITFLRKSDE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 74/154 (48%)
trappc3lXP_031758513.1 TRAPPC3_bet3 33..186 CDD:271345 74/152 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54086
OrthoDB 1 1.010 - - D1334804at2759
OrthoFinder 1 1.000 - - FOG0002640
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.