DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and Trappc3l

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_002729004.1 Gene:Trappc3l / 100362279 RGDID:2318506 Length:181 Species:Rattus norvegicus


Alignment Length:174 Identity:82/174 - (47%)
Similarity:117/174 - (67%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRQA-SRLDAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLARTSA 64
            |||.| .|.:..|:|.:...|||||||.|:.:|:|..|||||.|:::||::|.||:||||||:..
  Rat     1 MSRPAHKRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNKYLDKMGYSIGTRLVEDFLARSCV 65

  Fly    65 PRCLEMRETADRIQQ-AFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFV-ELPPDLTNLRYSA 127
            .||....|..|.|.| ||::||...|:::..:.:.:||||:...|||.||: |||...:.|.|..
  Rat    66 RRCHSYSEIIDIIAQVAFKMYLGTTPSVTCHNSSRNEFSLILHKNPLAEFIEELPAGRSALCYCN 130

  Fly   128 ILSGCIRGALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEE 171
            :|.|.||||||||.|.....|:||:||||||||:.:.|::::::
  Rat   131 LLCGIIRGALEMVHLAADVTFLQDRLKGDNVTEIGITFLKKVDD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 76/154 (49%)
Trappc3lXP_002729004.1 TRAPPC3_bet3 15..170 CDD:271345 76/154 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339852
Domainoid 1 1.000 190 1.000 Domainoid score I3173
eggNOG 1 0.900 - - E1_KOG3330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54086
OrthoDB 1 1.010 - - D1334804at2759
OrthoFinder 1 1.000 - - FOG0002640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13048
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1739
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.