DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bet3 and TRAPPC3L

DIOPT Version :9

Sequence 1:NP_648312.3 Gene:Bet3 / 39090 FlyBaseID:FBgn0260859 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001132916.1 Gene:TRAPPC3L / 100128327 HGNCID:21090 Length:181 Species:Homo sapiens


Alignment Length:174 Identity:83/174 - (47%)
Similarity:118/174 - (67%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRQASRL-DAKKVNSEFLTLTYGALVTQMLRDFENAEDVNKQLERIGYNMGMRLIEDFLARTSA 64
            |||.|.|. :..|:|.:...|||||||.|:.:|:|..||||:.|:::||.:|.||:||||||:..
Human     1 MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFLARSCV 65

  Fly    65 PRCLEMRETADRIQQ-AFRIYLNIQPTISNWSPASDEFSLVFDSNPLTEFV-ELPPDLTNLRYSA 127
            .||....|..|.|.| ||::||.|.|:::..:.:.:||||:.:.|||.||| |||...::|.|..
Human    66 GRCHSYSEIIDIIAQVAFKMYLGITPSVTCNNSSKNEFSLILEKNPLVEFVEELPAGRSSLCYCN 130

  Fly   128 ILSGCIRGALEMVQLEVQCWFVQDQLKGDNVTELRVKFVRRLEE 171
            :|.|.||||||||.|.....|:||:||||:|||:.:.|:::.:|
Human   131 LLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bet3NP_648312.3 TRAPPC3_bet3 14..167 CDD:271345 76/154 (49%)
TRAPPC3LNP_001132916.1 TRAPPC3_bet3 15..170 CDD:271345 76/154 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146091
Domainoid 1 1.000 188 1.000 Domainoid score I3316
eggNOG 1 0.900 - - E1_KOG3330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54086
OrthoDB 1 1.010 - - D1334804at2759
OrthoFinder 1 1.000 - - FOG0002640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1739
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.