DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTF-1 and wek

DIOPT Version :9

Sequence 1:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_001260472.1 Gene:wek / 48785 FlyBaseID:FBgn0001990 Length:470 Species:Drosophila melanogaster


Alignment Length:490 Identity:120/490 - (24%)
Similarity:183/490 - (37%) Gaps:117/490 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VTSNCSSSGSLDFDRPLAQLLEPKLEADGLG-IIHGDNYSIYGS--QTAESTSGEQQVLNL---- 109
            :.|.|       ||      :|..||...|| ::..:.||:.|.  ..::|.|..|.:..|    
  Fly    34 IISKC-------FD------VEMTLEEPELGSMLCEECYSVIGQLITFSDSVSKVQAIFELLRHS 85

  Fly   110 ---------GLTLDTGDAQATYGDLFGAQDQLTASQTHGHSQVVVSAAADNAFSLADQLTPLPIT 165
                     .|.|:.|...|...||    :.|....|            ::..||.::||     
  Fly    86 EPQDSQDLDALRLEYGLPPACKQDL----EFLDIDDT------------EDRCSLVEELT----- 129

  Fly   166 VIPITYHHTT-------------ENLSSSHSEVPLIASLSDITAQVFNLDDICFTLEYQFENQRL 217
               |:.|.|:             .||...:|:..::||.:....:|    :...:...||..:|.
  Fly   130 ---ISDHSTSPSPDFEAQTVRTRANLKQCNSDPKVLASPTASIPEV----ETKRSRRQQFAAKRN 187

  Fly   218 VQVQPPTVV-SLSMVSSPNEAANPP---INCDNDQGTGNSISRDSTSNSPAYFTIETSYVDEYDP 278
            .:|...|.. ....:...:||.:||   ......:|:|...:.|.:.|..:              
  Fly   188 SKVYTATESDDEEAILDEDEAVSPPPLKRKRGRPKGSGKQKNVDDSDNVTS-------------- 238

  Fly   279 NEPDEDEQLAHCIQPGVLHQDVDEEEVERQDENDQLMALAYESSDEALSRYRCNYENCYRSYSTI 343
            .|||                  |..:.::.|:..:|....:.|.......|.|..  |..::.:.
  Fly   239 REPD------------------DNAKSKQDDKTSELSMSPHGSQSSNFVDYPCKI--CNETFMSF 283

  Fly   344 GNLRTHL-KTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKAFNTRYRLH 407
            ..||.|. ..|.|...:.|  |.|.|...|..||..|..|||:.||..|.|  |:..|..:.||.
  Fly   284 MALRRHKHDMHGGPKKYVC--DHCGKGLKTFTSLVEHQLVHTEEKPCICPV--CNAGFKNKARLR 344

  Fly   408 AHLRLHNGETFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRTHTG 472
            .|.:.|....|.|.:|.|...|.:.|.||...||.||.:||  :.||.....|..||.|...|||
  Fly   345 VHSQTHGEPKFECNVCGKKLQTRAILNKHKYVHTDERRFKC--EVCGSGCKNSTALKIHLLGHTG 407

  Fly   473 EKPYPCQEDSCQKSFSTSHSLKSHKKTHQRQLQNK 507
            .:||.|:  .|.|:|:::.:.:|||.....:|.:|
  Fly   408 LRPYVCK--YCGKAFASNTNCRSHKWKKHPELASK 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 49/142 (35%)
C2H2 Zn finger 331..353 CDD:275368 5/22 (23%)
zf-H2C2_2 345..372 CDD:290200 9/27 (33%)
C2H2 Zn finger 361..383 CDD:275368 8/21 (38%)
zf-H2C2_2 375..402 CDD:290200 12/26 (46%)
C2H2 Zn finger 391..413 CDD:275368 7/21 (33%)
zf-C2H2 418..440 CDD:278523 8/21 (38%)
C2H2 Zn finger 420..440 CDD:275368 7/19 (37%)
zf-H2C2_2 432..458 CDD:290200 11/25 (44%)
COG5048 442..>519 CDD:227381 24/66 (36%)
C2H2 Zn finger 448..470 CDD:275368 7/21 (33%)
zf-H2C2_2 462..489 CDD:290200 12/26 (46%)
C2H2 Zn finger 478..500 CDD:275368 7/21 (33%)
DUF3682 862..>931 CDD:289231
wekNP_001260472.1 zf-AD 11..80 CDD:214871 15/58 (26%)
C2H2 Zn finger 273..294 CDD:275368 5/22 (23%)
C2H2 Zn finger 302..322 CDD:275368 8/21 (38%)
C2H2 Zn finger 330..350 CDD:275368 7/21 (33%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..405 CDD:275368 7/21 (33%)
zf-H2C2_2 397..422 CDD:290200 12/26 (46%)
C2H2 Zn finger 413..429 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.