DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTF-1 and Phs

DIOPT Version :9

Sequence 1:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_648789.3 Gene:Phs / 39697 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster


Alignment Length:723 Identity:161/723 - (22%)
Similarity:254/723 - (35%) Gaps:235/723 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SLSDSRD----YDTNSSRNSLSGSPPV--------TSNCSSSGSLDFDRPL-------------- 68
            ||.|.:|    .|.....|...|..||        |||.:.:|:...:..:              
  Fly   365 SLRDEQDNAEKTDKKKKLNKEEGQQPVLEPLQAKKTSNQAENGATQSNNVVKVQQNAKGSKKDGT 429

  Fly    69 --AQLLE--PKLEADGLGIIHGDNYSIYGSQTAESTSGEQQVLNLGLTLDTGDAQATYGDLFGAQ 129
              ||..|  ||         |.:|.........||.:.::.:.:..||:|......|..|....|
  Fly   430 QSAQKSETNPK---------HLENAETNSKDNTESVALKETIHDKQLTIDEAGKAGTQKDDNSNQ 485

  Fly   130 DQLTASQTHG---------HSQVVVSAAADNAFSLADQLTPLPITVIPITYHHTTE---NLSSSH 182
            .||..|:.:.         |.|:.|.:|.|:     .|:|..|.        ::|:   ......
  Fly   486 KQLDKSEANAGKSKMVDQVHQQMPVESAKDH-----QQMTEEPT--------NSTKRKRGRKERK 537

  Fly   183 SEVPLIASLSDITAQVFNLDDICFTLEYQFENQRLVQVQPPTVVSLSMVSSPNEAANPPINCDND 247
            |..|::..|.|...:.          |.:...:|:                              
  Fly   538 SPTPVLIPLGDKEIKE----------EPELPERRM------------------------------ 562

  Fly   248 QGTGNSISRDSTSNSPAYFTIETSYVDEYDPNEPDEDEQLAHCIQPGVLHQDVDEEEVE------ 306
                    |.|..:        ..||.|....|.|:||              |:|.||:      
  Fly   563 --------RKSRQH--------VDYVVEIKDEEEDDDE--------------VEEAEVDDDSSAT 597

  Fly   307 ----RQDENDQLMALAYESSDEALSR-----YRCNYENCYRSYSTIGNLRTHLKTHTGDYSFKCP 362
                ....::...::..|||:|:...     :.||:  |.:::.....::.||:.|||:..:.|.
  Fly   598 ISPHNSSTDESFTSIKRESSEESQHNGIGGIHTCNF--CGKTFKRFSRMQDHLRLHTGEKPYVCG 660

  Fly   363 EDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKAFNTRYRLHAHLRLH-NGETFNCELCQKC 426
            :  |.:||.....|..|...|...|.|:|::  |.....|:..|..|:|.| |...:.|:.|.|.
  Fly   661 Q--CGRAFRLKMRLVEHQLRHRAEKAYKCDI--CSMPLATKQDLSLHMRHHKNDRRYKCDKCNKG 721

  Fly   427 FTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTHRRT---------------------- 469
            |...|||..|:|.||.|:||.|  |.|||||.|..:|..||||                      
  Fly   722 FVRSSDLSIHVRIHTGEKPYSC--DLCGKAFRARQNLVVHRRTHLGDKPIQCELCDKRFARKIDM 784

  Fly   470 ------HTGEKPYPCQEDSCQKSFSTSHSLKSH-KKTHQRQLQNKGRKKRPLKTQQTKCSDQEQK 527
                  |||||||.|  |:||:.:|:..:|..| ::.|..:.|..|..:...|..:|...::::.
  Fly   785 RVHMRRHTGEKPYNC--DACQRGYSSRVNLLRHQEREHGIEEQVPGSGQADKKHTKTATENEQEN 847

  Fly   528 DPQQEEQEEEEFIKEDQPEMTLLNPGSHCSETTSTDSGVVLQTLTPQDHLSNVFILQGNEPLILP 592
            :|:.:....       :|....|.                 |.:..|:.|.|......:....:|
  Fly   848 EPKAKAAPR-------RPRREKLQ-----------------QKIAAQEKLLNDLKRSLSAMPEIP 888

  Fly   593 ETSQAYQLSYAAEEEIPSPWIDAG-------VLVSKPIIPMAPLTDACVALPTEMPSFVNLKPTF 650
            |.|...:|. .:.::||:   |||       |.:|..:.| ||.|:          ....:.|..
  Fly   889 EESAQVKLD-GSGQDIPA---DAGAGHAQVQVTLSMQMEP-APNTE----------DDEEITPEK 938

  Fly   651 GNAVSGNM 658
            .||:|.:|
  Fly   939 ENALSSSM 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 52/170 (31%)
C2H2 Zn finger 331..353 CDD:275368 5/21 (24%)
zf-H2C2_2 345..372 CDD:290200 9/26 (35%)
C2H2 Zn finger 361..383 CDD:275368 6/21 (29%)
zf-H2C2_2 375..402 CDD:290200 7/26 (27%)
C2H2 Zn finger 391..413 CDD:275368 6/21 (29%)
zf-C2H2 418..440 CDD:278523 9/21 (43%)
C2H2 Zn finger 420..440 CDD:275368 9/19 (47%)
zf-H2C2_2 432..458 CDD:290200 15/25 (60%)
COG5048 442..>519 CDD:227381 34/105 (32%)
C2H2 Zn finger 448..470 CDD:275368 13/49 (27%)
zf-H2C2_2 462..489 CDD:290200 16/54 (30%)
C2H2 Zn finger 478..500 CDD:275368 7/22 (32%)
DUF3682 862..>931 CDD:289231
PhsNP_648789.3 COG5048 <594..787 CDD:227381 56/200 (28%)
C2H2 Zn finger 631..651 CDD:275368 5/21 (24%)
zf-H2C2_2 644..666 CDD:290200 7/23 (30%)
zf-H2C2_2 699..724 CDD:290200 9/24 (38%)
zf-C2H2 713..735 CDD:278523 9/21 (43%)
C2H2 Zn finger 715..735 CDD:275368 9/19 (47%)
zf-H2C2_2 727..750 CDD:290200 14/24 (58%)
C2H2 Zn finger 743..763 CDD:275368 12/21 (57%)
zf-H2C2_2 755..780 CDD:290200 5/24 (21%)
C2H2 Zn finger 771..791 CDD:275368 0/19 (0%)
zf-H2C2_2 783..808 CDD:290200 11/26 (42%)
C2H2 Zn finger 799..816 CDD:275370 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.