DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTF-1 and CG1663

DIOPT Version :9

Sequence 1:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster


Alignment Length:421 Identity:105/421 - (24%)
Similarity:151/421 - (35%) Gaps:127/421 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 FNLDDICFTLEYQFE-----------NQRLVQVQPPTVVSLSMVSSPNEAANPPINCDNDQG--- 249
            ||.|:.....|.|.|           ..:|.:||.    |...|....|...|..:.:.:||   
  Fly    14 FNADEDEIQDEVQVEMTNLLAASIAQESKLAEVQE----SFKNVEFMEEEVEPNFSPEKEQGHDE 74

  Fly   250 -TGNSISRDSTSNSP--AYFTIETS------------------YVDEYDPNEPDE-------DEQ 286
             ..|| ..|..||.|  |:::::.:                  ::.|:..|:.|.       .|.
  Fly    75 LASNS-HHDYISNQPHKAFYSLQRTSPGVIQYFIQQLRRHKFFWITEHGINKKDRMDSSQKVAEA 138

  Fly   287 LAH----CIQPGVLHQDVDEEEV--ERQDENDQLMALAYESSDEALSRYRCNY------------ 333
            |.|    .:.|.|::......:|  |||    .:|.|:  |||     :||.|            
  Fly   139 LFHRFHFQLDPKVVNASARFLQVWFERQ----YVMQLS--SSD-----FRCRYPKYYHSLLKFMP 192

  Fly   334 ---------ENCYRSYSTIGNLRTH-LKTHTGDYSFKCPEDGCHKAFLTSYSLKIH-VRVHTKVK 387
                     |.|.|.:.....||.| .:.|.|.....|  ..||::|..:..|:.| .|.|.|..
  Fly   193 TNHISVTICEECDRRFLNERLLRLHKFRVHGGPNPNVC--HVCHQSFPLASKLEQHQARYHFKRP 255

  Fly   388 PYECEVSGCDKAFNTRYRLHAHLRLHNGE-TFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPED 451
            .::|  |.||....:::....|..:|.|: .:.||||.....|.|.|..|.|||.|.: ..||. 
  Fly   256 EWQC--SRCDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAVHRRTHDQPK-LCCPH- 316

  Fly   452 DCGKAFTASHHLKTH-RRTHTGEKPYPCQEDSCQKSFSTSHSLKSHKKTHQRQLQNKGRKKRPLK 515
             |.:.|..:..||:| |:.|.|........|.|.:.|.|...||.||..|   ||:         
  Fly   317 -CSRQFRENSTLKSHIRKIHDGNSARQVSCDFCWRRFKTLELLKLHKLVH---LQS--------- 368

  Fly   516 TQQTKCSDQEQKDPQQEEQEEEEFIKEDQPE 546
                               ||.|..::|.||
  Fly   369 -------------------EEMESYEDDDPE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 47/166 (28%)
C2H2 Zn finger 331..353 CDD:275368 8/43 (19%)
zf-H2C2_2 345..372 CDD:290200 9/27 (33%)
C2H2 Zn finger 361..383 CDD:275368 7/22 (32%)
zf-H2C2_2 375..402 CDD:290200 9/27 (33%)
C2H2 Zn finger 391..413 CDD:275368 5/21 (24%)
zf-C2H2 418..440 CDD:278523 9/21 (43%)
C2H2 Zn finger 420..440 CDD:275368 9/19 (47%)
zf-H2C2_2 432..458 CDD:290200 9/25 (36%)
COG5048 442..>519 CDD:227381 22/77 (29%)
C2H2 Zn finger 448..470 CDD:275368 8/22 (36%)
zf-H2C2_2 462..489 CDD:290200 9/27 (33%)
C2H2 Zn finger 478..500 CDD:275368 8/21 (38%)
DUF3682 862..>931 CDD:289231
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 15/62 (24%)
C2H2 Zn finger 201..222 CDD:275368 6/20 (30%)
C2H2 Zn finger 259..279 CDD:275368 5/21 (24%)
C2H2 Zn finger 287..307 CDD:275368 9/19 (47%)
C2H2 Zn finger 314..335 CDD:275368 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.