DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTF-1 and esg

DIOPT Version :9

Sequence 1:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:508 Identity:114/508 - (22%)
Similarity:183/508 - (36%) Gaps:162/508 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SHGNSLSDSRDYDTNSSRNSLSGSPPVTSNCSSSGSLDFDRPLAQLLEPK--LEADGLGIIHGDN 88
            :|.|:.::.:|.                  |.....:..:.|..:|:...  .|.:|:.:.|.|:
  Fly    32 NHSNTPNEPQDL------------------CVKKMEILEENPSEELINVSDCCEDEGVDVDHTDD 78

  Fly    89 YSIYGSQTAESTSGEQQVLNLGLTLDTGDAQATYGDLFGAQDQLTASQTHGHSQVVVSAAADNAF 153
                     |....|.:.:::.:..|....||.                     .:.:|||..|.
  Fly    79 ---------EHIEEEDEDVDVDVDSDPNQTQAA---------------------ALAAAAAVAAA 113

  Fly   154 SLADQLTPLPITVIPITYHHTTENLSSSHSEVPLIASLSDITAQVFNLDDICFTLEYQFENQRLV 218
            :.|..:.|.|      ||.....|  :.|        :|..||:.           |:..||:..
  Fly   114 AAASVVVPTP------TYPKYPWN--NFH--------MSPYTAEF-----------YRTINQQGH 151

  Fly   219 QVQPPTVVSLSMVSSPNE---AANPPINCDNDQGTGNSISRDSTSN------------------- 261
            |:. |....|...|||::   :.:||.: ....|..:|:|....|.                   
  Fly   152 QIL-PLRGDLIAPSSPSDSLGSLSPPPH-HYLHGRASSVSPPMRSEIIHRPIGVRQHRFLPYPQM 214

  Fly   262 -------------------SPAYFTIETSY--VDEYDPNEP-----DEDEQLAH--------CIQ 292
                               ||||  .|.||  :....|...     .||..|.|        ..|
  Fly   215 PGYPSLGGYTHTHHHHAPISPAY--SENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNTSQ 277

  Fly   293 PGVLHQDVDEEEVERQDENDQLMALAYESSDE-ALSRYRCNYENCYRSYSTIGNLRTHLKTH--- 353
            ||      ::...:..|.:.:.|..|....|: ...||:|  .:|.:||||...|..|.:.|   
  Fly   278 PG------EQAAAKTGDMSPETMPNASAKKDKNQPPRYQC--PDCQKSYSTFSGLTKHQQFHCPA 334

  Fly   354 -TGDY---SFKCPEDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKAFNTRYRLHAHLRLHN 414
             .|:.   ||.|.:  |.|.:::..:||:|:|.||  .|.:|.:  |.|||:..:.|..|:|.|.
  Fly   335 AEGNQVKKSFSCKD--CDKTYVSLGALKMHIRTHT--LPCKCNL--CGKAFSRPWLLQGHIRTHT 393

  Fly   415 GE-TFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHLKTH 466
            || .|:|:.|.:.|...|:|:.|::||:..:.|.|  ..|.|.|:....|..|
  Fly   394 GEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSC--TSCSKTFSRMSLLTKH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 50/146 (34%)
C2H2 Zn finger 331..353 CDD:275368 8/21 (38%)
zf-H2C2_2 345..372 CDD:290200 9/33 (27%)
C2H2 Zn finger 361..383 CDD:275368 7/21 (33%)
zf-H2C2_2 375..402 CDD:290200 12/26 (46%)
C2H2 Zn finger 391..413 CDD:275368 8/21 (38%)
zf-C2H2 418..440 CDD:278523 7/21 (33%)
C2H2 Zn finger 420..440 CDD:275368 6/19 (32%)
zf-H2C2_2 432..458 CDD:290200 8/25 (32%)
COG5048 442..>519 CDD:227381 7/25 (28%)
C2H2 Zn finger 448..470 CDD:275368 6/19 (32%)
zf-H2C2_2 462..489 CDD:290200 2/5 (40%)
C2H2 Zn finger 478..500 CDD:275368
DUF3682 862..>931 CDD:289231
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 9/23 (39%)
C2H2 Zn finger 311..331 CDD:275370 8/21 (38%)
zf-C2H2 344..366 CDD:278523 8/23 (35%)
C2H2 Zn finger 346..366 CDD:275368 7/21 (33%)
zf-C2H2 370..392 CDD:278523 8/23 (35%)
C2H2 Zn finger 372..392 CDD:275368 8/21 (38%)
zf-H2C2_2 385..408 CDD:290200 9/22 (41%)
zf-C2H2 398..420 CDD:278523 7/21 (33%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..444 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24377
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.