DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTF-1 and Cf2

DIOPT Version :9

Sequence 1:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:488 Identity:109/488 - (22%)
Similarity:160/488 - (32%) Gaps:149/488 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VTSNCSSS-GSLDFDRPLAQLLEPKL--------EADGLGIIHGDNY----------------SI 91
            :|.|...: .:||...|.|| ..|||        |..|..:...:::                ||
  Fly    99 ITLNAQGAIATLDGGHPQAQ-QHPKLSHPCFNCDEKFGNAVDLDEHHRLAHQTPAFLSRCLMCSI 162

  Fly    92 YGSQTAESTSGEQQVLNLGLTLDTGDAQATYGDLFGAQDQLTASQTHGHSQVVVSAAADNAFSLA 156
            ||..:|.....|.:....|....|.              .|.|.|.....|...:...|      
  Fly   163 YGIHSATQQPNEYKCTQCGSICTTA--------------MLAAGQQGFMEQQEAAVTPD------ 207

  Fly   157 DQL---TPLPITVIPITYHHTTENLSSSHSEVPLIASLSDITAQVFNLDDICFTLEYQFENQRLV 218
            |||   .|..:.:.|...||..:..:..|.:............|...|:.....::.|.:.|::.
  Fly   208 DQLPAMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQQQQQQQQQQQELLEQQQREMQEQAQQQQVH 272

  Fly   219 QVQ--------------PPTVVSLSMVSSPNEAANPPINCDNDQGTGNSISRDSTSNSPAYFTIE 269
            ..|              ||..|.|:..::.....:.|.....::....|.|.|..::.|.     
  Fly   273 HHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIVSHPQVIIKEEPLSLSDSGDVVNSVPV----- 332

  Fly   270 TSYVDEYDPNEPDEDEQLAHCIQPGVLHQDVDEEEVERQDENDQLMALAYESSDEALSRYRCNYE 334
              |..:.:|..|..       ...|||   |..:.|...        ||::      .|::|  .
  Fly   333 --YAIQANPGVPAP-------ASSGVL---VGTQTVPAD--------LAHK------IRHKC--P 369

  Fly   335 NCYRSYSTIGNLRTHLKTHTGDYSFKCPEDGCHKAFLTSYSLKIHVRVHTKVKPYECEVSGCDKA 399
            :|.:::.|.|.|..|.|.|||:                       .....|.:||.|  |.|.|:
  Fly   370 DCPKTFKTPGTLAMHRKIHTGE-----------------------ADATPKERPYTC--SYCGKS 409

  Fly   400 FNTRYRLHAHLRLHNGE-TFNCELCQKCFTTLSDLKKHMRTHTQERPYKCPEDDCGKAFTASHHL 463
            |.....|..|.|:|.|| .|:|..|:|.|:....|.||:||||.|:||.||.  |.|.||     
  Fly   410 FTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPY--CDKRFT----- 467

  Fly   464 KTHRRTHTGEKPYPCQEDSCQKSFSTSHSLKSH 496
                                |:|..|.|:.|.|
  Fly   468 --------------------QRSALTVHTTKLH 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 45/142 (32%)
C2H2 Zn finger 331..353 CDD:275368 7/21 (33%)
zf-H2C2_2 345..372 CDD:290200 6/26 (23%)
C2H2 Zn finger 361..383 CDD:275368 0/21 (0%)
zf-H2C2_2 375..402 CDD:290200 8/26 (31%)
C2H2 Zn finger 391..413 CDD:275368 8/21 (38%)
zf-C2H2 418..440 CDD:278523 9/21 (43%)
C2H2 Zn finger 420..440 CDD:275368 8/19 (42%)
zf-H2C2_2 432..458 CDD:290200 14/25 (56%)
COG5048 442..>519 CDD:227381 15/55 (27%)
C2H2 Zn finger 448..470 CDD:275368 6/21 (29%)
zf-H2C2_2 462..489 CDD:290200 2/26 (8%)
C2H2 Zn finger 478..500 CDD:275368 6/19 (32%)
DUF3682 862..>931 CDD:289231
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 47/160 (29%)
C2H2 Zn finger 368..388 CDD:275368 7/21 (33%)
C2H2 Zn finger 403..423 CDD:275368 8/21 (38%)
C2H2 Zn finger 431..451 CDD:275368 8/19 (42%)
zf-H2C2_2 443..468 CDD:316026 16/51 (31%)
C2H2 Zn finger 459..480 CDD:275368 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.