DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS17 and RPS17A

DIOPT Version :9

Sequence 1:NP_524002.1 Gene:RpS17 / 39088 FlyBaseID:FBgn0005533 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_013688.1 Gene:RPS17A / 854984 SGDID:S000004486 Length:136 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:73/123 - (59%)
Similarity:92/123 - (74%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQ 65
            ||||||||||:|:|.:||:||.:|||||.||||:|:|:|.|.:|.||||||||.||||.|::...
Yeast     1 MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRIQKGP 65

  Fly    66 VRGISIKLQEEERERRDNYVPAVSALE----QDIIEVDADTKEMLKLLDFHNIRGLQL 119
            |||||.|||||||||:|.|||.||||:    ..::.||..|.:::|.|      ||:|
Yeast    66 VRGISFKLQEEERERKDQYVPEVSALDLSRSNGVLNVDNQTSDLVKSL------GLKL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS17NP_524002.1 Ribosomal_S17e 1..122 CDD:395671 73/123 (59%)
RPS17ANP_013688.1 Ribosomal_S17e 1..115 CDD:395671 70/119 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346196
Domainoid 1 1.000 142 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG1383
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1176
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53898
OrthoFinder 1 1.000 - - FOG0001108
OrthoInspector 1 1.000 - - otm46849
orthoMCL 1 0.900 - - OOG6_100832
Panther 1 1.100 - - O PTHR10732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1234
SonicParanoid 1 1.000 - - X671
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.