DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS17 and AT3G10610

DIOPT Version :9

Sequence 1:NP_524002.1 Gene:RpS17 / 39088 FlyBaseID:FBgn0005533 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_187672.1 Gene:AT3G10610 / 820230 AraportID:AT3G10610 Length:140 Species:Arabidopsis thaliana


Alignment Length:135 Identity:80/135 - (59%)
Similarity:102/135 - (75%) Gaps:8/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQ 65
            |||||||||||:::.:|||||:|:||||||||:|.|||||||:|.|||||||:.||||.|::...
plant     1 MGRVRTKTVKKSSRQVIEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGP 65

  Fly    66 VRGISIKLQEEERERRDNYVPAVSALEQDIIEVDADTKEMLKLLDFHNIRGLQLTQPNTNN---- 126
            |||||:||||||||||.::||..||::.|.::||.:|.|||..|...:|.|  ::|..|..    
plant    66 VRGISLKLQEEERERRMDFVPDESAIKIDDVKVDKETLEMLASLGMSDIAG--ISQVETQQAMAP 128

  Fly   127 --FGR 129
              |||
plant   129 AVFGR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS17NP_524002.1 Ribosomal_S17e 1..122 CDD:395671 75/120 (63%)
AT3G10610NP_187672.1 Ribosomal_S17e 1..120 CDD:395671 75/120 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1388
eggNOG 1 0.900 - - E1_COG1383
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I1690
OMA 1 1.010 - - QHG53898
OrthoDB 1 1.010 - - D1459807at2759
OrthoFinder 1 1.000 - - FOG0001108
OrthoInspector 1 1.000 - - otm2583
orthoMCL 1 0.900 - - OOG6_100832
Panther 1 1.100 - - O PTHR10732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X671
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.