DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS17 and RGD1562381

DIOPT Version :9

Sequence 1:NP_524002.1 Gene:RpS17 / 39088 FlyBaseID:FBgn0005533 Length:131 Species:Drosophila melanogaster
Sequence 2:XP_234319.3 Gene:RGD1562381 / 314248 RGDID:1562381 Length:135 Species:Rattus norvegicus


Alignment Length:128 Identity:89/128 - (69%)
Similarity:103/128 - (80%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQ 65
            |||:.||.:||||.||||||||.|..|||||||:|:|:|.||:|.:.|||||||||||.|::...
  Rat     1 MGRICTKAMKKAAWVIIEKYYTCLDNDFHTNKRVCKEIANIPSKNIWNKIAGYVTHLMKRIQRGP 65

  Fly    66 VRGISIKLQEEERERRDNYVPAVSALEQDIIEVDADTKEMLKLLDFHNIRGLQLTQPNT-NNF 127
            ||||.||||||||||||||||..|||:|:|.|||.|||||||||||.::..||:|||.. .||
  Rat    66 VRGIPIKLQEEERERRDNYVPEGSALDQEITEVDPDTKEMLKLLDFGSLSNLQVTQPTVGRNF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS17NP_524002.1 Ribosomal_S17e 1..122 CDD:395671 85/120 (71%)
RGD1562381XP_234319.3 Ribosomal_S17e 1..119 CDD:279206 83/117 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353011
Domainoid 1 1.000 196 1.000 Domainoid score I3029
eggNOG 1 0.900 - - E1_COG1383
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3714
OMA 1 1.010 - - QHG53898
OrthoDB 1 1.010 - - D1459807at2759
OrthoFinder 1 1.000 - - FOG0001108
OrthoInspector 1 1.000 - - otm45744
orthoMCL 1 0.900 - - OOG6_100832
Panther 1 1.100 - - O PTHR10732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X671
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.