DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS17 and rps1702

DIOPT Version :9

Sequence 1:NP_524002.1 Gene:RpS17 / 39088 FlyBaseID:FBgn0005533 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_588012.1 Gene:rps1702 / 2539331 PomBaseID:SPCC24B10.09 Length:132 Species:Schizosaccharomyces pombe


Alignment Length:114 Identity:80/114 - (70%)
Similarity:93/114 - (81%) Gaps:0/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQ 65
            ||||||||.|:|::|:|||||.||||||.|||||.:|||||.:|.||||||||.||||.|::...
pombe     1 MGRVRTKTTKRASRVVIEKYYPRLTLDFQTNKRIVDEVAIIASKRLRNKIAGYTTHLMKRIQRGP 65

  Fly    66 VRGISIKLQEEERERRDNYVPAVSALEQDIIEVDADTKEMLKLLDFHNI 114
            |||||.|||||||||:|.|||.||.||:|.|.||.|||:|||.|.:.:|
pombe    66 VRGISFKLQEEERERKDQYVPEVSELEKDKINVDQDTKDMLKALGYDSI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS17NP_524002.1 Ribosomal_S17e 1..122 CDD:395671 80/114 (70%)
rps1702NP_588012.1 Ribosomal_S17e 1..119 CDD:279206 80/114 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 160 1.000 Domainoid score I981
eggNOG 1 0.900 - - E1_COG1383
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1245
OMA 1 1.010 - - QHG53898
OrthoFinder 1 1.000 - - FOG0001108
OrthoInspector 1 1.000 - - otm47305
orthoMCL 1 0.900 - - OOG6_100832
Panther 1 1.100 - - LDO PTHR10732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1234
SonicParanoid 1 1.000 - - X671
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.