DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS17 and rps-17

DIOPT Version :9

Sequence 1:NP_524002.1 Gene:RpS17 / 39088 FlyBaseID:FBgn0005533 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_491795.1 Gene:rps-17 / 172313 WormBaseID:WBGene00004486 Length:130 Species:Caenorhabditis elegans


Alignment Length:115 Identity:77/115 - (66%)
Similarity:93/115 - (80%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQ 65
            |.||||||||||::|:|||||||:|.|||.|||:|:|||||.:||||||||||:||||.|:....
 Worm     1 MSRVRTKTVKKASRVLIEKYYTRMTNDFHNNKRVCDEVAIIGSKPLRNKIAGYITHLMRRIERGP 65

  Fly    66 VRGISIKLQEEERERRDNYVPAVSALEQD---IIEVDADTKEMLKLLDFH 112
            |||||||||||||||||||:|.:|.::..   .|:||.||.:|||...|:
 Worm    66 VRGISIKLQEEERERRDNYMPEISTVDPSQLTSIKVDTDTSDMLKAAGFN 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS17NP_524002.1 Ribosomal_S17e 1..122 CDD:395671 77/115 (67%)
rps-17NP_491795.1 Ribosomal_S17e 1..121 CDD:279206 77/115 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166554
Domainoid 1 1.000 157 1.000 Domainoid score I2550
eggNOG 1 0.900 - - E1_COG1383
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I2913
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53898
OrthoDB 1 1.010 - - D1459807at2759
OrthoFinder 1 1.000 - - FOG0001108
OrthoInspector 1 1.000 - - oto19477
orthoMCL 1 0.900 - - OOG6_100832
Panther 1 1.100 - - LDO PTHR10732
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1234
SonicParanoid 1 1.000 - - X671
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.