DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS17 and LOC100362366

DIOPT Version :9

Sequence 1:NP_524002.1 Gene:RpS17 / 39088 FlyBaseID:FBgn0005533 Length:131 Species:Drosophila melanogaster
Sequence 2:XP_038962175.1 Gene:LOC100362366 / 100362366 RGDID:2318320 Length:135 Species:Rattus norvegicus


Alignment Length:128 Identity:100/128 - (78%)
Similarity:111/128 - (86%) Gaps:1/128 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVRTKTVKKAAKVIIEKYYTRLTLDFHTNKRICEEVAIIPTKPLRNKIAGYVTHLMGRLRHSQ 65
            |||||||||||||:||||||||||..|||||||:|||:||||:|.|||||||||||||.|::...
  Rat     1 MGRVRTKTVKKAARVIIEKYYTRLGNDFHTNKRVCEEIAIIPSKNLRNKIAGYVTHLMKRIQRGP 65

  Fly    66 VRGISIKLQEEERERRDNYVPAVSALEQDIIEVDADTKEMLKLLDFHNIRGLQLTQPNTN-NF 127
            .||||||||||||||||||||.||||:|:|||||.|||||||||||.::..||:|||... ||
  Rat    66 GRGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKLLDFGSLSNLQVTQPTVGMNF 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS17NP_524002.1 Ribosomal_S17e 1..122 CDD:395671 96/120 (80%)
LOC100362366XP_038962175.1 Ribosomal_S17e 1..122 CDD:395671 96/120 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353010
Domainoid 1 1.000 196 1.000 Domainoid score I3029
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 199 1.000 Inparanoid score I3714
OMA 1 1.010 - - QHG53898
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001108
OrthoInspector 1 1.000 - - otm45744
orthoMCL 1 0.900 - - OOG6_100832
Panther 1 1.100 - - O PTHR10732
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X671
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.