DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atat and Atat1

DIOPT Version :10

Sequence 1:NP_648309.1 Gene:Atat / 39086 FlyBaseID:FBgn0035989 Length:461 Species:Drosophila melanogaster
Sequence 2:NP_001136216.1 Gene:Atat1 / 73242 MGIID:1913869 Length:421 Species:Mus musculus


Alignment Length:52 Identity:17/52 - (32%)
Similarity:18/52 - (34%) Gaps:22/52 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DKAYFVDLFV------------RASNTPAIKMY-----EKLGY-----IIYR 131
            ||.|||..||            |....|..|.|     ..|||     |:||
Mouse   224 DKLYFVLDFVNGGELFFHLQKERTFPEPRAKFYIAEMASALGYLHSLNIVYR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AtatNP_648309.1 Acetyltransf_16 9..189 CDD:461616 17/52 (33%)
Atat1NP_001136216.1 Acetyltransf_16 10..190 CDD:461616
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..235 7/10 (70%)
PHA03378 <209..326 CDD:223065 17/52 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..284 8/24 (33%)
Required for AP2A2-binding 308..387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.