DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aay and PYP1

DIOPT Version :9

Sequence 1:NP_524001.2 Gene:aay / 39085 FlyBaseID:FBgn0023129 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_014388.3 Gene:PYP1 / 855722 SGDID:S000004955 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:41/190 - (21%)
Similarity:75/190 - (39%) Gaps:26/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IVCFDVDSTVICEEGIDELAEYCGKGSEV-ARVTKEAMGGAMTF-QDALKIRLNIIRPTQQQVRD 125
            ::..|.|.||..|:..|.|.:..|.|.|. .:|.:..:....:| |..:::..:|..|..:.:: 
Yeast     5 VIFTDFDGTVTLEDSNDYLTDTLGFGKEKRLKVFEGVLDDTKSFRQGFMEMLESIHTPFPECIK- 68

  Fly   126 FIQERPSTLSKNVKRFVSHLKAEGKQVYLISGGFDCLIAPVANEL----GIPLKNVYANKMLFDY 186
             |.|:...|....|......:.....|.::|.|...:|..:...|    .|...::.:|::    
Yeast    69 -ILEKKIRLDPGFKDTFEWAQENDVPVIVVSSGMKPIIKVLLTRLVGQESIHKIDIVSNEV---- 128

  Fly   187 LGEYDSFD----INQPTSRSG-GKAEAIALIRKE-------NSDDSLITMIGDGATDLEA 234
              |.|:.|    |.:..|..| .|:.:|...:|:       .....:....|||.:||.|
Yeast   129 --EIDAHDQWKIIYKDESPFGHDKSRSIDAYKKKFESTLKAGEQRPVYFYCGDGVSDLSA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aayNP_524001.2 HAD_like 54..268 CDD:304363 41/190 (22%)
Hydrolase 63..234 CDD:279092 40/188 (21%)
PYP1NP_014388.3 MtnX 1..234 CDD:226802 41/190 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.