DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aay and PSP

DIOPT Version :9

Sequence 1:NP_524001.2 Gene:aay / 39085 FlyBaseID:FBgn0023129 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_973858.1 Gene:PSP / 838445 AraportID:AT1G18640 Length:295 Species:Arabidopsis thaliana


Alignment Length:264 Identity:115/264 - (43%)
Similarity:156/264 - (59%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LARP-AAATNGHNLLTKQLNCNGNGTTGGAAKTTVASAITPPKQPQLAAKVIQQSQIVCFDVDST 71
            |.|| .|:...|.|.|  |...||              |.|.|:   ...:.:..:.||||||||
plant    48 LLRPVTASVQPHELST--LGHEGN--------------IVPSKE---ILDLWRSVEAVCFDVDST 93

  Fly    72 VICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALKIRLNIIRPTQQQVRDFIQERPSTLSK 136
            |..:||||||||:||.|..||..|..||||::.|::||..||::.:|:..:|.:::.:||..||.
plant    94 VCVDEGIDELAEFCGAGKAVAEWTARAMGGSVPFEEALAARLSLFKPSLSKVEEYLDKRPPRLSP 158

  Fly   137 NVKRFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPTSR 201
            .::..|..|:|....||||||||..:|.|||:.||||.:|::||.:||...||:..||.|:||||
plant   159 GIEELVKKLRANNIDVYLISGGFRQMINPVASILGIPRENIFANNLLFGNSGEFLGFDENEPTSR 223

  Fly   202 SGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPP--ANYFIGFGGNVVRPEVYRRAQYYVTDF 264
            |||||:|:..|||.....:: .|||||||||||..|  |:.||.:.|..:|..|...|.:.:..|
plant   224 SGGKAKAVQQIRKGRLYKTM-AMIGDGATDLEARKPGGADLFICYAGVQLREAVAANADWLIFKF 287

  Fly   265 EQLM 268
            |.|:
plant   288 ESLI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aayNP_524001.2 HAD_like 54..268 CDD:304363 101/215 (47%)
Hydrolase 63..234 CDD:279092 89/170 (52%)
PSPNP_973858.1 PLN02954 72..295 CDD:215514 104/224 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 178 1.000 Domainoid score I1062
eggNOG 1 0.900 - - E1_COG0560
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31245
Inparanoid 1 1.050 191 1.000 Inparanoid score I1383
OMA 1 1.010 - - QHG57974
OrthoDB 1 1.010 - - D1009123at2759
OrthoFinder 1 1.000 - - FOG0003213
OrthoInspector 1 1.000 - - oto2938
orthoMCL 1 0.900 - - OOG6_101696
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4217
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.