DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aay and psph

DIOPT Version :9

Sequence 1:NP_524001.2 Gene:aay / 39085 FlyBaseID:FBgn0023129 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001028271.1 Gene:psph / 606663 ZFINID:ZDB-GENE-050809-127 Length:226 Species:Danio rerio


Alignment Length:211 Identity:105/211 - (49%)
Similarity:159/211 - (75%) Gaps:1/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALKIRLNIIRPTQQ 121
            :::::..||||||||||.||||||||::||.|..|..:|::||||:|:||.||..||:||:.:::
Zfish    10 LLRRADAVCFDVDSTVIREEGIDELAKFCGVGDAVTEMTRKAMGGSMSFQTALSERLSIIKCSRE 74

  Fly   122 QVRDFIQERPSTLSKNVKRFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDY 186
            ||...|.:.|..|:..::..|..|:..|.||:|:||||.|::..||::|.|||::||||::.|.:
Zfish    75 QVNKLITDHPPQLTPGIRELVQKLQQRGVQVFLVSGGFRCIVEHVASQLSIPLQHVYANRLKFYF 139

  Fly   187 LGEYDSFDINQPTSRSGGKAEAIALIRKENSDDSLITMIGDGATDLEAVPPANYFIGFGGNVVRP 251
            .|||..||.:|||::||||...|:::::::...::: |||||||||||.|||:.||||||||:||
Zfish   140 NGEYAGFDESQPTAQSGGKGRVISMLKEKHGFQNIL-MIGDGATDLEACPPASAFIGFGGNVLRP 203

  Fly   252 EVYRRAQYYVTDFEQL 267
            :|..::.:||:.|.:|
Zfish   204 QVKEKSSWYVSSFSEL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aayNP_524001.2 HAD_like 54..268 CDD:304363 105/211 (50%)
Hydrolase 63..234 CDD:279092 85/170 (50%)
psphNP_001028271.1 PLN02954 9..224 CDD:215514 105/211 (50%)
Hydrolase 15..186 CDD:279092 85/171 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581475
Domainoid 1 1.000 180 1.000 Domainoid score I3475
eggNOG 1 0.900 - - E1_COG0560
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31245
Inparanoid 1 1.050 222 1.000 Inparanoid score I3509
OMA 1 1.010 - - QHG57974
OrthoDB 1 1.010 - - D1009123at2759
OrthoFinder 1 1.000 - - FOG0003213
OrthoInspector 1 1.000 - - oto38995
orthoMCL 1 0.900 - - OOG6_101696
Panther 1 1.100 - - LDO PTHR43344
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1319
SonicParanoid 1 1.000 - - X4217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.