DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aay and ser2

DIOPT Version :9

Sequence 1:NP_524001.2 Gene:aay / 39085 FlyBaseID:FBgn0023129 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_595768.1 Gene:ser2 / 2540968 PomBaseID:SPBC3H7.07c Length:298 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:60/195 - (30%)
Similarity:98/195 - (50%) Gaps:7/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 QSQIVCFDVDSTVICEEGIDELAEYCGKGSEVARVTKEAMGGAMTFQDALKIRLNIIRPTQQQVR 124
            :.::|.||:|||:|.:|.|||||...|...|||.:|..||.|.:.||::|:.|:::::.....|.
pombe    75 KKKLVVFDMDSTLIQQECIDELAAEAGIQKEVATITSLAMNGEIDFQESLRRRVSLLQGLSVDVI 139

  Fly   125 DFIQERPSTLSKNVKRFVSHLKAEGKQVYLISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGE 189
            :.:..: .|.:...|:....||..|..:.:.||||..:...|..:|  .|...|||.:.|...|:
pombe   140 NKVIGK-ITFTPGAKQLCHCLKQMGATLVVASGGFVPMAEYVKGQL--DLDYAYANVLEFSDDGK 201

  Fly   190 YDSFDINQPTSRSGGKAEAIALIRKENSDDSLITM-IGDGATDLEAVPPANYFIGFGGNVVRPEV 253
            :.:..:.........||..:...|:|...:.|.|| :||||.||..:..:...|.|   ..:|:|
pombe   202 FLTGKVQGAIVDGQRKASILREKREELGLNKLETMAVGDGANDLVMMAESGLGIAF---KAKPKV 263

  Fly   254  253
            pombe   264  263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aayNP_524001.2 HAD_like 54..268 CDD:304363 60/195 (31%)
Hydrolase 63..234 CDD:279092 56/171 (33%)
ser2NP_595768.1 SerB 75..284 CDD:223634 60/195 (31%)
Hydrolase 77..252 CDD:279092 56/177 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I2624
eggNOG 1 0.900 - - E1_COG0560
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1898
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003213
OrthoInspector 1 1.000 - - oto101073
orthoMCL 1 0.900 - - OOG6_101696
Panther 1 1.100 - - LDO PTHR43344
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1319
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.