DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aay and Y62E10A.13

DIOPT Version :9

Sequence 1:NP_524001.2 Gene:aay / 39085 FlyBaseID:FBgn0023129 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001293893.1 Gene:Y62E10A.13 / 178304 WormBaseID:WBGene00013379 Length:287 Species:Caenorhabditis elegans


Alignment Length:248 Identity:115/248 - (46%)
Similarity:152/248 - (61%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AKTTVASAI-----TPP------KQPQLAAKVIQQSQIVCFDVDSTVICEEGIDELAEYCGKGSE 90
            |..|.||||     |.|      ...:...:|.:::..|||||||||..:|||||||.|.|.|..
 Worm    27 ALPTTASAIPRSISTSPGETISKNHEEEVKRVWRKADAVCFDVDSTVCQDEGIDELAAYLGVGEA 91

  Fly    91 VARVTKEAMGGAMTF--QDALKIRLNIIRPTQQQVRDFIQERPSTLSKNVKRFVSHLKAEGKQVY 153
            ||.||:.||.|...|  :|||..||.:::|..:|:..|:......|:..::..||.|.|.|..||
 Worm    92 VANVTRTAMNGNARFRYRDALAARLQVMKPNHEQLEQFVNISKPKLTVGIRELVSRLHARGTHVY 156

  Fly   154 LISGGFDCLIAPVANELGIPLKNVYANKMLFDYLGEYDSFDINQPTSRSG----GKAEAIALIRK 214
            |:||||..||.|||..|||....:|||::|||..|:|..||.::.||.||    ||...|||::|
 Worm   157 LVSGGFRRLILPVAELLGIEKSRIYANEILFDKFGKYHGFDTSELTSDSGSKETGKPAVIALLKK 221

  Fly   215 ENSDDSLITMIGDGATDLEAVPPANYFIGFGGNVVRPEVYRRAQYYVTDFEQL 267
            ..:..::: |:||||||:||.|||:.||||||||:|..|..||::|||||:.|
 Worm   222 MYNYKTVV-MVGDGATDVEASPPADAFIGFGGNVIREGVKARAKWYVTDFDVL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aayNP_524001.2 HAD_like 54..268 CDD:304363 107/220 (49%)
Hydrolase 63..234 CDD:279092 83/176 (47%)
Y62E10A.13NP_001293893.1 PLN02954 53..278 CDD:215514 107/222 (48%)
Hydrolase 63..240 CDD:279092 83/177 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159651
Domainoid 1 1.000 152 1.000 Domainoid score I2646
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31245
Inparanoid 1 1.050 196 1.000 Inparanoid score I2515
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57974
OrthoDB 1 1.010 - - D1009123at2759
OrthoFinder 1 1.000 - - FOG0003213
OrthoInspector 1 1.000 - - oto17801
orthoMCL 1 0.900 - - OOG6_101696
Panther 1 1.100 - - LDO PTHR43344
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1319
SonicParanoid 1 1.000 - - X4217
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.